Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JZD2

Protein Details
Accession A0A197JZD2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
56-78ACVPYKFKNNKRGWKEERREGARHydrophilic
NLS Segment(s)
PositionSequence
68-70GWK
73-73R
Subcellular Location(s) mito 7cyto 7cyto_mito 7, nucl 6
Family & Domain DBs
Amino Acid Sequences MGLMSMKENRSGKRDQLPEERQDKREEAGACVLCSCVSIGWCVCVQVYLYVKVVGACVPYKFKNNKRGWKEERREGAREMERSQDRGRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.58
4 0.61
5 0.64
6 0.67
7 0.67
8 0.6
9 0.58
10 0.53
11 0.43
12 0.43
13 0.35
14 0.29
15 0.3
16 0.28
17 0.24
18 0.22
19 0.21
20 0.15
21 0.14
22 0.12
23 0.06
24 0.05
25 0.06
26 0.06
27 0.07
28 0.07
29 0.07
30 0.07
31 0.06
32 0.06
33 0.08
34 0.1
35 0.1
36 0.1
37 0.11
38 0.11
39 0.11
40 0.11
41 0.08
42 0.08
43 0.08
44 0.09
45 0.12
46 0.14
47 0.22
48 0.31
49 0.38
50 0.47
51 0.56
52 0.65
53 0.69
54 0.78
55 0.79
56 0.82
57 0.83
58 0.82
59 0.83
60 0.79
61 0.75
62 0.67
63 0.67
64 0.63
65 0.58
66 0.51
67 0.5
68 0.47
69 0.49