Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DME7

Protein Details
Accession J9DME7   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
26-58EEKIKKQVFDKKGKIKPEKQKQLTDKKGNIKKEBasic
NLS Segment(s)
PositionSequence
24-56RDEEKIKKQVFDKKGKIKPEKQKQLTDKKGNIK
153-196DGKGAAGGKGGKGAAGGKGGKGAAGGKGGKGGKGAAGGKGGKGE
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 7
Family & Domain DBs
Amino Acid Sequences MIPGEPESAVKSAGESIDKAKPVRDEEKIKKQVFDKKGKIKPEKQKQLTDKKGNIKKELTDDKGKLNINNLDEKGNIKKELLDENGNVEKGVLDQKGKVKNDLYDEEGNTKEELLDDRSRLKKFFFDKDGILNKNRLINFLKRITGRYRSQGDGKGAAGGKGGKGAAGGKGGKGAAGGKGGKGGKGAAGGKGGKGEKTGEYVPDALEPISEQPVDDEKREEPPSTAVLSGNERLPDRNSPINEEEDEEGQPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.18
4 0.23
5 0.26
6 0.26
7 0.28
8 0.31
9 0.35
10 0.4
11 0.44
12 0.49
13 0.55
14 0.66
15 0.72
16 0.69
17 0.67
18 0.68
19 0.7
20 0.69
21 0.7
22 0.69
23 0.7
24 0.74
25 0.8
26 0.83
27 0.83
28 0.84
29 0.85
30 0.86
31 0.83
32 0.86
33 0.86
34 0.87
35 0.87
36 0.86
37 0.83
38 0.82
39 0.82
40 0.78
41 0.75
42 0.67
43 0.6
44 0.59
45 0.59
46 0.55
47 0.55
48 0.51
49 0.48
50 0.51
51 0.49
52 0.42
53 0.39
54 0.38
55 0.33
56 0.36
57 0.33
58 0.29
59 0.27
60 0.29
61 0.28
62 0.27
63 0.25
64 0.2
65 0.21
66 0.22
67 0.26
68 0.26
69 0.24
70 0.21
71 0.24
72 0.26
73 0.24
74 0.22
75 0.17
76 0.13
77 0.12
78 0.15
79 0.11
80 0.1
81 0.13
82 0.19
83 0.26
84 0.27
85 0.29
86 0.27
87 0.29
88 0.32
89 0.32
90 0.31
91 0.26
92 0.26
93 0.26
94 0.25
95 0.23
96 0.18
97 0.16
98 0.11
99 0.09
100 0.09
101 0.11
102 0.13
103 0.13
104 0.18
105 0.23
106 0.25
107 0.25
108 0.24
109 0.26
110 0.28
111 0.33
112 0.32
113 0.29
114 0.29
115 0.35
116 0.39
117 0.36
118 0.34
119 0.3
120 0.27
121 0.29
122 0.28
123 0.25
124 0.23
125 0.24
126 0.28
127 0.29
128 0.31
129 0.28
130 0.31
131 0.32
132 0.36
133 0.34
134 0.36
135 0.37
136 0.35
137 0.38
138 0.39
139 0.37
140 0.32
141 0.29
142 0.26
143 0.23
144 0.2
145 0.17
146 0.13
147 0.11
148 0.11
149 0.1
150 0.06
151 0.07
152 0.07
153 0.07
154 0.1
155 0.11
156 0.09
157 0.11
158 0.11
159 0.1
160 0.1
161 0.1
162 0.07
163 0.1
164 0.11
165 0.09
166 0.15
167 0.15
168 0.15
169 0.15
170 0.14
171 0.12
172 0.16
173 0.16
174 0.12
175 0.15
176 0.15
177 0.15
178 0.2
179 0.2
180 0.16
181 0.17
182 0.18
183 0.15
184 0.19
185 0.2
186 0.17
187 0.18
188 0.18
189 0.17
190 0.16
191 0.16
192 0.12
193 0.1
194 0.1
195 0.09
196 0.11
197 0.11
198 0.1
199 0.11
200 0.18
201 0.21
202 0.22
203 0.23
204 0.22
205 0.29
206 0.32
207 0.31
208 0.26
209 0.27
210 0.28
211 0.27
212 0.26
213 0.2
214 0.2
215 0.23
216 0.24
217 0.24
218 0.24
219 0.23
220 0.25
221 0.28
222 0.31
223 0.33
224 0.38
225 0.38
226 0.42
227 0.44
228 0.46
229 0.43
230 0.4
231 0.37
232 0.31