Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197KGY5

Protein Details
Accession A0A197KGY5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
143-169MLRKMPPKLPKPPKPPSQPPKPQHRASHydrophilic
NLS Segment(s)
PositionSequence
145-165RKMPPKLPKPPKPPSQPPKPQ
Subcellular Location(s) nucl 15, cyto_nucl 13.5, cyto 10
Family & Domain DBs
Amino Acid Sequences MGIFDDDDSDVGSETSYYSDASVESFGEPEPGSSSWLRVSKTWTSFKGKNVAHFDISDDEEELGLGSPLNHHIEHSTSFSTANADSPTAPTPYYATKDGYTTPARSQSNMASSMLPPQVSQSPIAVQETSSGIELIPIKFPSMLRKMPPKLPKPPKPPSQPPKPQHRASDKIPLEVVSTVEPKPKCPLKLQIKLILPIRFNFTPQINLQALTFFQPNCPTAASTHQPIES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.08
3 0.08
4 0.07
5 0.07
6 0.08
7 0.08
8 0.09
9 0.09
10 0.09
11 0.09
12 0.09
13 0.09
14 0.11
15 0.11
16 0.1
17 0.12
18 0.12
19 0.15
20 0.14
21 0.16
22 0.19
23 0.23
24 0.24
25 0.23
26 0.28
27 0.33
28 0.39
29 0.44
30 0.44
31 0.48
32 0.51
33 0.54
34 0.58
35 0.52
36 0.53
37 0.54
38 0.52
39 0.45
40 0.41
41 0.39
42 0.32
43 0.32
44 0.24
45 0.17
46 0.14
47 0.12
48 0.12
49 0.1
50 0.07
51 0.05
52 0.05
53 0.04
54 0.05
55 0.07
56 0.1
57 0.09
58 0.09
59 0.1
60 0.12
61 0.14
62 0.16
63 0.15
64 0.13
65 0.13
66 0.13
67 0.14
68 0.12
69 0.12
70 0.1
71 0.1
72 0.09
73 0.11
74 0.12
75 0.11
76 0.11
77 0.1
78 0.11
79 0.13
80 0.16
81 0.16
82 0.16
83 0.16
84 0.17
85 0.17
86 0.2
87 0.2
88 0.19
89 0.19
90 0.24
91 0.24
92 0.24
93 0.25
94 0.22
95 0.22
96 0.22
97 0.21
98 0.14
99 0.14
100 0.17
101 0.16
102 0.14
103 0.11
104 0.11
105 0.12
106 0.12
107 0.13
108 0.1
109 0.1
110 0.11
111 0.12
112 0.1
113 0.08
114 0.08
115 0.09
116 0.09
117 0.08
118 0.07
119 0.06
120 0.08
121 0.09
122 0.09
123 0.1
124 0.09
125 0.1
126 0.11
127 0.11
128 0.16
129 0.2
130 0.22
131 0.24
132 0.33
133 0.37
134 0.44
135 0.52
136 0.53
137 0.58
138 0.66
139 0.72
140 0.73
141 0.78
142 0.8
143 0.8
144 0.85
145 0.83
146 0.83
147 0.84
148 0.82
149 0.85
150 0.83
151 0.8
152 0.78
153 0.78
154 0.73
155 0.66
156 0.7
157 0.59
158 0.53
159 0.48
160 0.39
161 0.32
162 0.26
163 0.23
164 0.15
165 0.16
166 0.15
167 0.21
168 0.21
169 0.21
170 0.28
171 0.33
172 0.34
173 0.37
174 0.47
175 0.51
176 0.6
177 0.64
178 0.64
179 0.62
180 0.64
181 0.65
182 0.59
183 0.5
184 0.42
185 0.43
186 0.36
187 0.34
188 0.33
189 0.29
190 0.28
191 0.28
192 0.33
193 0.27
194 0.27
195 0.26
196 0.23
197 0.21
198 0.2
199 0.22
200 0.15
201 0.17
202 0.21
203 0.21
204 0.22
205 0.23
206 0.21
207 0.2
208 0.28
209 0.3
210 0.31