Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9D941

Protein Details
Accession J9D941    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
83-105ITSKKQIYKETPRKAKNKYFPNQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.333, mito_nucl 11.666, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045318  EZH1/2-like  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
Gene Ontology GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF00856  SET  
PROSITE View protein in PROSITE  
PS50280  SET  
Amino Acid Sequences MDMNKDSEYFRIGFTPCSKDCWRNKNDLIVEDISLPEDIQEFIRELSQNFEINSCFAYLCLKYRFDTEKTCSELFSYIKKNNITSKKQIYKETPRKAKNKYFPNQIFNACSHLGSCENNSKCSCYKSKTYCEVYCRCQCCNNAFFCSCNSCNSNCPCFLSCRECTSLCHTNCSNKAIQNGLYKDTKIMESYTAGFGLFAGEDIDVDTFVIEYTGELVSNQEADRRGFFYDYKKLSYLFDLTEDLDFTTLDATRIGNNARFINHGGENEANLIAKPFMVNGMLKMAMYSSRKIRKGEELLFNYNYNNEHKQAHNISK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.32
4 0.39
5 0.43
6 0.48
7 0.57
8 0.61
9 0.62
10 0.64
11 0.67
12 0.7
13 0.68
14 0.61
15 0.57
16 0.48
17 0.43
18 0.34
19 0.3
20 0.21
21 0.17
22 0.15
23 0.1
24 0.09
25 0.08
26 0.08
27 0.1
28 0.09
29 0.1
30 0.13
31 0.14
32 0.14
33 0.17
34 0.2
35 0.2
36 0.19
37 0.2
38 0.18
39 0.17
40 0.18
41 0.14
42 0.11
43 0.09
44 0.12
45 0.12
46 0.17
47 0.2
48 0.22
49 0.22
50 0.27
51 0.33
52 0.33
53 0.38
54 0.38
55 0.4
56 0.44
57 0.43
58 0.38
59 0.34
60 0.34
61 0.29
62 0.31
63 0.31
64 0.29
65 0.34
66 0.36
67 0.38
68 0.43
69 0.51
70 0.5
71 0.52
72 0.6
73 0.63
74 0.65
75 0.69
76 0.68
77 0.71
78 0.75
79 0.77
80 0.76
81 0.76
82 0.79
83 0.82
84 0.83
85 0.8
86 0.8
87 0.78
88 0.79
89 0.76
90 0.74
91 0.69
92 0.62
93 0.55
94 0.45
95 0.41
96 0.31
97 0.25
98 0.19
99 0.16
100 0.15
101 0.14
102 0.16
103 0.2
104 0.21
105 0.25
106 0.25
107 0.27
108 0.27
109 0.31
110 0.33
111 0.29
112 0.37
113 0.4
114 0.47
115 0.51
116 0.56
117 0.56
118 0.58
119 0.58
120 0.57
121 0.57
122 0.53
123 0.46
124 0.44
125 0.43
126 0.41
127 0.41
128 0.36
129 0.33
130 0.31
131 0.3
132 0.27
133 0.3
134 0.25
135 0.23
136 0.23
137 0.19
138 0.24
139 0.28
140 0.29
141 0.24
142 0.26
143 0.24
144 0.24
145 0.26
146 0.26
147 0.24
148 0.25
149 0.27
150 0.25
151 0.26
152 0.31
153 0.36
154 0.31
155 0.34
156 0.31
157 0.34
158 0.36
159 0.37
160 0.33
161 0.26
162 0.28
163 0.25
164 0.28
165 0.28
166 0.27
167 0.27
168 0.26
169 0.24
170 0.23
171 0.22
172 0.19
173 0.13
174 0.13
175 0.11
176 0.11
177 0.12
178 0.12
179 0.11
180 0.1
181 0.09
182 0.08
183 0.07
184 0.06
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.04
200 0.05
201 0.05
202 0.05
203 0.05
204 0.06
205 0.07
206 0.07
207 0.09
208 0.1
209 0.12
210 0.13
211 0.14
212 0.15
213 0.16
214 0.18
215 0.22
216 0.29
217 0.3
218 0.32
219 0.31
220 0.31
221 0.3
222 0.31
223 0.27
224 0.19
225 0.18
226 0.17
227 0.17
228 0.16
229 0.15
230 0.12
231 0.1
232 0.09
233 0.07
234 0.08
235 0.07
236 0.07
237 0.07
238 0.08
239 0.09
240 0.11
241 0.14
242 0.16
243 0.19
244 0.2
245 0.2
246 0.22
247 0.23
248 0.25
249 0.25
250 0.22
251 0.23
252 0.22
253 0.21
254 0.2
255 0.19
256 0.14
257 0.12
258 0.12
259 0.09
260 0.08
261 0.08
262 0.07
263 0.07
264 0.09
265 0.1
266 0.1
267 0.13
268 0.13
269 0.13
270 0.12
271 0.12
272 0.16
273 0.18
274 0.21
275 0.27
276 0.36
277 0.41
278 0.44
279 0.48
280 0.52
281 0.58
282 0.62
283 0.63
284 0.61
285 0.62
286 0.62
287 0.59
288 0.5
289 0.43
290 0.38
291 0.34
292 0.32
293 0.29
294 0.3
295 0.32
296 0.4