Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JKX0

Protein Details
Accession A0A197JKX0   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
168-194LMRKIQQRKESAKDRERKGKKGKCLILBasic
NLS Segment(s)
PositionSequence
175-190RKESAKDRERKGKKGK
Subcellular Location(s) nucl 14.5, cyto_nucl 13.166, cyto 9.5, mito_nucl 8.499, cyto_mito 5.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
IPR020849  Small_GTPase_Ras-type  
Gene Ontology GO:0016020  C:membrane  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0007165  P:signal transduction  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
PS51421  RAS  
PS51420  RHO  
CDD cd04139  RalA_RalB  
Amino Acid Sequences MGKKAKQDLPLHKVIMVGSGGVGKSALTLQYMYGDFVEEYDPTKADSYRKKVTLDNQDCQIDILDTAGQEEYAAIRDNYYRSGEGFICVFSLCEYESFMHTQEFKDQISRVLDDNKIPFILVGNKADLTQLRKVNREEAAARAAEWNCPYYETSAKTRHNVDEVYTVLMRKIQQRKESAKDRERKGKKGKCLIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.34
3 0.25
4 0.17
5 0.11
6 0.12
7 0.11
8 0.09
9 0.09
10 0.06
11 0.07
12 0.08
13 0.08
14 0.07
15 0.07
16 0.07
17 0.11
18 0.11
19 0.11
20 0.11
21 0.11
22 0.1
23 0.1
24 0.11
25 0.08
26 0.1
27 0.1
28 0.1
29 0.11
30 0.12
31 0.14
32 0.2
33 0.28
34 0.33
35 0.4
36 0.43
37 0.44
38 0.47
39 0.54
40 0.58
41 0.56
42 0.53
43 0.5
44 0.47
45 0.45
46 0.4
47 0.32
48 0.21
49 0.14
50 0.11
51 0.07
52 0.06
53 0.07
54 0.06
55 0.05
56 0.05
57 0.05
58 0.04
59 0.05
60 0.06
61 0.05
62 0.06
63 0.08
64 0.08
65 0.1
66 0.12
67 0.11
68 0.11
69 0.13
70 0.13
71 0.12
72 0.12
73 0.1
74 0.09
75 0.08
76 0.08
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.07
84 0.08
85 0.08
86 0.09
87 0.1
88 0.1
89 0.12
90 0.13
91 0.12
92 0.14
93 0.13
94 0.16
95 0.17
96 0.18
97 0.16
98 0.18
99 0.19
100 0.19
101 0.19
102 0.17
103 0.15
104 0.14
105 0.12
106 0.1
107 0.13
108 0.14
109 0.13
110 0.14
111 0.14
112 0.14
113 0.15
114 0.16
115 0.16
116 0.19
117 0.24
118 0.26
119 0.3
120 0.32
121 0.36
122 0.36
123 0.35
124 0.31
125 0.28
126 0.28
127 0.24
128 0.22
129 0.22
130 0.21
131 0.2
132 0.2
133 0.18
134 0.16
135 0.17
136 0.17
137 0.16
138 0.2
139 0.21
140 0.27
141 0.34
142 0.38
143 0.4
144 0.44
145 0.43
146 0.42
147 0.39
148 0.36
149 0.31
150 0.28
151 0.28
152 0.25
153 0.22
154 0.19
155 0.21
156 0.21
157 0.26
158 0.34
159 0.38
160 0.44
161 0.53
162 0.61
163 0.68
164 0.75
165 0.77
166 0.78
167 0.8
168 0.81
169 0.83
170 0.83
171 0.84
172 0.85
173 0.84
174 0.84