Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JG83

Protein Details
Accession A0A197JG83    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-26DVTWMSKKKVRYRNARPGHAKCRCRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MDVTWMSKKKVRYRNARPGHAKCRCRVCLLCSCAPVAQAMPRDEIFKEKAREGREGSKVKDMNFGTECQELHAHSNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.86
4 0.86
5 0.85
6 0.86
7 0.85
8 0.79
9 0.74
10 0.74
11 0.67
12 0.63
13 0.57
14 0.51
15 0.51
16 0.52
17 0.49
18 0.4
19 0.38
20 0.32
21 0.3
22 0.24
23 0.16
24 0.13
25 0.13
26 0.13
27 0.14
28 0.14
29 0.15
30 0.15
31 0.18
32 0.19
33 0.21
34 0.23
35 0.25
36 0.29
37 0.31
38 0.35
39 0.36
40 0.4
41 0.43
42 0.45
43 0.44
44 0.48
45 0.48
46 0.45
47 0.48
48 0.41
49 0.39
50 0.36
51 0.34
52 0.29
53 0.3
54 0.29
55 0.24
56 0.25
57 0.2