Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9DA69

Protein Details
Accession J9DA69    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
22-46KADKRPPKTGRGRKREKYEKRLALGBasic
NLS Segment(s)
PositionSequence
10-42AGKVRKQTPKVEKADKRPPKTGRGRKREKYEKR
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MAKAVTLNRAGKVRKQTPKVEKADKRPPKTGRGRKREKYEKRLALGLFEFKKVKFNEQTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.59
3 0.66
4 0.69
5 0.76
6 0.78
7 0.78
8 0.76
9 0.75
10 0.8
11 0.79
12 0.75
13 0.74
14 0.7
15 0.69
16 0.73
17 0.74
18 0.73
19 0.75
20 0.79
21 0.79
22 0.85
23 0.87
24 0.86
25 0.86
26 0.86
27 0.82
28 0.75
29 0.72
30 0.62
31 0.55
32 0.47
33 0.45
34 0.36
35 0.33
36 0.32
37 0.27
38 0.34
39 0.32
40 0.38