Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JE19

Protein Details
Accession A0A197JE19   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MNEQERKKKNRREKRIENRKKNGMKRKLKTQVFVBasic
NLS Segment(s)
PositionSequence
6-29RKKKNRREKRIENRKKNGMKRKLK
Subcellular Location(s) nucl 9, plas 7, cyto 6, mito_nucl 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNEQERKKKNRREKRIENRKKNGMKRKLKTQVFVKVQRENGNKVRYVVHALQRWLFFFVGVTVVVVIGGVVPIVESVDVLLPFCERRRERVWCKKKVATWWGVQIDGPCCTKLLWFTKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.96
3 0.96
4 0.96
5 0.94
6 0.93
7 0.92
8 0.91
9 0.91
10 0.9
11 0.89
12 0.85
13 0.86
14 0.86
15 0.81
16 0.78
17 0.74
18 0.73
19 0.71
20 0.73
21 0.67
22 0.62
23 0.62
24 0.63
25 0.59
26 0.56
27 0.54
28 0.5
29 0.45
30 0.41
31 0.38
32 0.31
33 0.33
34 0.31
35 0.3
36 0.29
37 0.29
38 0.31
39 0.29
40 0.29
41 0.25
42 0.2
43 0.14
44 0.1
45 0.09
46 0.07
47 0.06
48 0.06
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.02
55 0.02
56 0.02
57 0.01
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.07
70 0.09
71 0.18
72 0.18
73 0.25
74 0.32
75 0.41
76 0.52
77 0.62
78 0.7
79 0.71
80 0.78
81 0.78
82 0.76
83 0.76
84 0.74
85 0.69
86 0.63
87 0.62
88 0.56
89 0.5
90 0.46
91 0.4
92 0.34
93 0.31
94 0.28
95 0.2
96 0.19
97 0.18
98 0.19
99 0.23