Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D6B5

Protein Details
Accession J9D6B5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
68-98HLVLRLRGGAKKKRRRRMQHQKRLKQSASVQHydrophilic
NLS Segment(s)
PositionSequence
73-92LRGGAKKKRRRRMQHQKRLK
Subcellular Location(s) nucl 16.5, cyto_nucl 14.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR019954  Ubiquitin_CS  
IPR019956  Ubiquitin_dom  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS00299  UBIQUITIN_1  
PS50053  UBIQUITIN_2  
CDD cd01803  Ubl_ubiquitin  
Amino Acid Sequences MQIFVKTLTGKTITLDVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKKRRRRMQHQKRLKQSASVQNKSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.15
4 0.15
5 0.15
6 0.15
7 0.11
8 0.11
9 0.1
10 0.12
11 0.12
12 0.1
13 0.13
14 0.16
15 0.18
16 0.21
17 0.23
18 0.26
19 0.26
20 0.33
21 0.34
22 0.33
23 0.32
24 0.33
25 0.32
26 0.31
27 0.3
28 0.23
29 0.22
30 0.22
31 0.2
32 0.18
33 0.18
34 0.14
35 0.17
36 0.17
37 0.15
38 0.13
39 0.13
40 0.12
41 0.11
42 0.11
43 0.09
44 0.15
45 0.17
46 0.18
47 0.2
48 0.19
49 0.18
50 0.18
51 0.2
52 0.17
53 0.16
54 0.14
55 0.16
56 0.18
57 0.19
58 0.19
59 0.18
60 0.17
61 0.2
62 0.28
63 0.34
64 0.42
65 0.52
66 0.62
67 0.71
68 0.8
69 0.87
70 0.9
71 0.92
72 0.93
73 0.94
74 0.95
75 0.94
76 0.94
77 0.94
78 0.84
79 0.81
80 0.78
81 0.78
82 0.77