Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D684

Protein Details
Accession J9D684   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
85-109SIAFLKKQKARKNEWFRHQNYKTNKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 5pero 5, nucl 4.5, E.R. 4, cyto_nucl 3.5, plas 3, golg 2, cyto 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIHFNLFALKNFLHVTILDTCIFFLCRYLFYYSDLKILFNIFFVRIFLLCDDGLFRKNTQHKFTVLLICRDTSIILHYNFKQIFSIAFLKKQKARKNEWFRHQNYKTNKFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.16
4 0.19
5 0.16
6 0.15
7 0.15
8 0.15
9 0.16
10 0.12
11 0.11
12 0.1
13 0.1
14 0.13
15 0.16
16 0.16
17 0.18
18 0.22
19 0.21
20 0.24
21 0.23
22 0.2
23 0.18
24 0.18
25 0.15
26 0.12
27 0.12
28 0.09
29 0.08
30 0.08
31 0.09
32 0.07
33 0.08
34 0.07
35 0.08
36 0.07
37 0.07
38 0.08
39 0.08
40 0.1
41 0.1
42 0.11
43 0.15
44 0.22
45 0.27
46 0.3
47 0.31
48 0.3
49 0.33
50 0.35
51 0.37
52 0.32
53 0.31
54 0.28
55 0.26
56 0.25
57 0.22
58 0.19
59 0.11
60 0.12
61 0.13
62 0.14
63 0.17
64 0.18
65 0.25
66 0.25
67 0.25
68 0.23
69 0.19
70 0.18
71 0.18
72 0.25
73 0.2
74 0.27
75 0.3
76 0.36
77 0.42
78 0.5
79 0.54
80 0.56
81 0.64
82 0.68
83 0.75
84 0.79
85 0.84
86 0.86
87 0.83
88 0.86
89 0.83
90 0.8
91 0.8