Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JZI2

Protein Details
Accession A0A197JZI2   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
53-81MVTPKKTTAPKNTKKKKPTMSLTKKKSSSHydrophilic
NLS Segment(s)
PositionSequence
61-71APKNTKKKKPT
Subcellular Location(s) plas 10, nucl 6.5, cyto_nucl 6.5, cyto 5.5, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGEEELNPQECQWLEGRRYHDVQSYLLPNDIDDVESGCVVFCFCVCVYVSLFMVTPKKTTAPKNTKKKKPTMSLTKKKSSSISSTSIHGGVSLGYSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.35
4 0.36
5 0.39
6 0.39
7 0.39
8 0.35
9 0.33
10 0.32
11 0.31
12 0.27
13 0.26
14 0.23
15 0.18
16 0.18
17 0.16
18 0.12
19 0.08
20 0.09
21 0.07
22 0.07
23 0.07
24 0.05
25 0.05
26 0.05
27 0.05
28 0.03
29 0.05
30 0.05
31 0.06
32 0.07
33 0.08
34 0.08
35 0.1
36 0.1
37 0.08
38 0.08
39 0.09
40 0.11
41 0.1
42 0.1
43 0.1
44 0.13
45 0.17
46 0.23
47 0.33
48 0.41
49 0.51
50 0.62
51 0.72
52 0.78
53 0.82
54 0.86
55 0.84
56 0.83
57 0.83
58 0.83
59 0.84
60 0.85
61 0.85
62 0.85
63 0.78
64 0.72
65 0.66
66 0.6
67 0.55
68 0.5
69 0.47
70 0.4
71 0.4
72 0.39
73 0.34
74 0.29
75 0.22
76 0.17
77 0.12
78 0.11