Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8ZUL7

Protein Details
Accession J8ZUL7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-30LKNNNNCKKSGRPRGRPRKSNFINFNHydrophilic
NLS Segment(s)
PositionSequence
13-23KSGRPRGRPRK
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MFSFLKNNNNCKKSGRPRGRPRKSNFINFNINFGQKTHQFKPKDNIFCHNYRKLFFPFVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.69
3 0.7
4 0.79
5 0.88
6 0.93
7 0.92
8 0.88
9 0.88
10 0.83
11 0.82
12 0.77
13 0.71
14 0.7
15 0.61
16 0.58
17 0.48
18 0.42
19 0.33
20 0.27
21 0.25
22 0.21
23 0.28
24 0.29
25 0.35
26 0.38
27 0.43
28 0.51
29 0.57
30 0.6
31 0.56
32 0.59
33 0.56
34 0.61
35 0.64
36 0.63
37 0.58
38 0.51
39 0.54
40 0.51