Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JU46

Protein Details
Accession A0A197JU46    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
39-76ARMGWKEKGRKQKNNNRRKKKTKKKERRREGEKKGMELBasic
NLS Segment(s)
PositionSequence
30-89GRKKERGREARMGWKEKGRKQKNNNRRKKKTKKKERRREGEKKGMELEKKRDEKEKESKN
Subcellular Location(s) nucl 17, mito 7, plas 1, extr 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MIVKIEEGNECCLIMTLLLMMRCNGEGVSGRKKERGREARMGWKEKGRKQKNNNRRKKKTKKKERRREGEKKGMELEKKRDEKEKESKNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.06
4 0.07
5 0.08
6 0.08
7 0.08
8 0.09
9 0.09
10 0.09
11 0.08
12 0.07
13 0.11
14 0.15
15 0.24
16 0.27
17 0.29
18 0.35
19 0.38
20 0.42
21 0.48
22 0.53
23 0.52
24 0.55
25 0.59
26 0.62
27 0.67
28 0.66
29 0.57
30 0.55
31 0.54
32 0.52
33 0.59
34 0.58
35 0.61
36 0.67
37 0.76
38 0.8
39 0.84
40 0.89
41 0.89
42 0.91
43 0.93
44 0.94
45 0.94
46 0.95
47 0.96
48 0.96
49 0.96
50 0.97
51 0.97
52 0.96
53 0.96
54 0.95
55 0.94
56 0.93
57 0.86
58 0.79
59 0.74
60 0.7
61 0.67
62 0.63
63 0.62
64 0.61
65 0.63
66 0.62
67 0.65
68 0.64
69 0.66
70 0.69