Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197KGK6

Protein Details
Accession A0A197KGK6   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
107-130DRDRDDRRRRSSRSRSPYRRGGRSBasic
208-232DVSGVDIKKQRKHRQYMNRRGGFNRHydrophilic
NLS Segment(s)
PositionSequence
53-145GGGGGGRDRDRSRDRRDYRGGDRGDRGRRDDYGRHDAGGRRDYRERDRSDRDRGDRDRDDRRRRSSRSRSPYRRGGRSRSRSPRGGRRGKDNK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MPYSPSPDRSNSRRGPPKDWDAPEEEDGEISYNNNTSSRRSGASGGYRDSRSGGGGGGRDRDRSRDRRDYRGGDRGDRGRRDDYGRHDAGGRRDYRERDRSDRDRGDRDRDDRRRRSSRSRSPYRRGGRSRSRSPRGGRRGKDNKDDDSGDDKDRKSRKDDKKMDEDSVDATKPLEELTPEEQEARMMAMMGFGGFDSTKGKKVAGADVSGVDIKKQRKHRQYMNRRGGFNRPLDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.71
3 0.71
4 0.75
5 0.74
6 0.71
7 0.65
8 0.6
9 0.59
10 0.54
11 0.47
12 0.37
13 0.28
14 0.24
15 0.2
16 0.15
17 0.11
18 0.1
19 0.09
20 0.1
21 0.13
22 0.14
23 0.17
24 0.21
25 0.23
26 0.24
27 0.25
28 0.27
29 0.3
30 0.37
31 0.36
32 0.35
33 0.37
34 0.36
35 0.35
36 0.33
37 0.28
38 0.21
39 0.18
40 0.15
41 0.12
42 0.14
43 0.15
44 0.19
45 0.19
46 0.23
47 0.23
48 0.29
49 0.36
50 0.41
51 0.49
52 0.54
53 0.58
54 0.63
55 0.7
56 0.7
57 0.68
58 0.69
59 0.63
60 0.56
61 0.57
62 0.56
63 0.56
64 0.52
65 0.49
66 0.43
67 0.43
68 0.44
69 0.43
70 0.42
71 0.43
72 0.4
73 0.36
74 0.37
75 0.37
76 0.38
77 0.39
78 0.33
79 0.29
80 0.33
81 0.37
82 0.42
83 0.47
84 0.47
85 0.48
86 0.55
87 0.57
88 0.61
89 0.64
90 0.61
91 0.61
92 0.59
93 0.6
94 0.56
95 0.56
96 0.57
97 0.6
98 0.66
99 0.65
100 0.7
101 0.71
102 0.71
103 0.77
104 0.77
105 0.78
106 0.78
107 0.81
108 0.81
109 0.79
110 0.84
111 0.8
112 0.79
113 0.74
114 0.73
115 0.72
116 0.72
117 0.75
118 0.75
119 0.74
120 0.72
121 0.73
122 0.74
123 0.74
124 0.75
125 0.67
126 0.68
127 0.72
128 0.71
129 0.74
130 0.68
131 0.61
132 0.56
133 0.54
134 0.46
135 0.41
136 0.38
137 0.32
138 0.32
139 0.29
140 0.33
141 0.37
142 0.37
143 0.39
144 0.47
145 0.54
146 0.61
147 0.7
148 0.7
149 0.74
150 0.76
151 0.72
152 0.62
153 0.52
154 0.43
155 0.37
156 0.29
157 0.19
158 0.15
159 0.12
160 0.11
161 0.11
162 0.09
163 0.07
164 0.1
165 0.14
166 0.16
167 0.17
168 0.17
169 0.17
170 0.16
171 0.16
172 0.13
173 0.09
174 0.07
175 0.06
176 0.06
177 0.05
178 0.05
179 0.05
180 0.04
181 0.05
182 0.04
183 0.05
184 0.09
185 0.11
186 0.15
187 0.16
188 0.16
189 0.18
190 0.21
191 0.27
192 0.26
193 0.26
194 0.23
195 0.23
196 0.25
197 0.24
198 0.22
199 0.17
200 0.2
201 0.25
202 0.32
203 0.42
204 0.51
205 0.59
206 0.69
207 0.77
208 0.83
209 0.88
210 0.92
211 0.92
212 0.89
213 0.83
214 0.78
215 0.76
216 0.72