Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JRY7

Protein Details
Accession A0A197JRY7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
83-111LPCCIAQRTNRHREHQRRKKTFGRQTEMAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR009060  UBA-like_sf  
Pfam View protein in Pfam  
PF14555  UBA_4  
Amino Acid Sequences MNSLTQDQRSKTQTLISIINIKEQPAIALLRDAKWDIQVAVNNYYNGATAAPQTNTKQSEPVNSKQIEKIFEDFKGMLPFCFLPCCIAQRTNRHREHQRRKKTFGRQTEMASYCSRTGVKMERRYQQAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.31
4 0.34
5 0.32
6 0.37
7 0.33
8 0.29
9 0.26
10 0.23
11 0.21
12 0.16
13 0.16
14 0.1
15 0.14
16 0.15
17 0.14
18 0.16
19 0.17
20 0.15
21 0.15
22 0.16
23 0.12
24 0.14
25 0.16
26 0.17
27 0.2
28 0.21
29 0.2
30 0.2
31 0.19
32 0.16
33 0.13
34 0.11
35 0.07
36 0.07
37 0.09
38 0.09
39 0.12
40 0.13
41 0.17
42 0.19
43 0.19
44 0.21
45 0.2
46 0.27
47 0.3
48 0.32
49 0.34
50 0.33
51 0.34
52 0.33
53 0.35
54 0.29
55 0.26
56 0.25
57 0.19
58 0.18
59 0.19
60 0.17
61 0.16
62 0.18
63 0.16
64 0.13
65 0.14
66 0.14
67 0.12
68 0.13
69 0.11
70 0.1
71 0.11
72 0.14
73 0.15
74 0.2
75 0.25
76 0.35
77 0.45
78 0.53
79 0.58
80 0.63
81 0.71
82 0.77
83 0.83
84 0.83
85 0.85
86 0.84
87 0.86
88 0.87
89 0.87
90 0.86
91 0.84
92 0.82
93 0.75
94 0.71
95 0.72
96 0.64
97 0.56
98 0.49
99 0.41
100 0.33
101 0.32
102 0.28
103 0.2
104 0.23
105 0.3
106 0.38
107 0.45
108 0.51
109 0.56