Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JVB9

Protein Details
Accession A0A197JVB9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
50-75SSGAKKQKTTPPCDRCRQRRLTDGNNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MAIPPQNPFQFHQVNHPSNTASYQEPVMKAAPPSTATIDPSLAAHNNSSSSGAKKQKTTPPCDRCRQRRLTDGNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.47
4 0.4
5 0.35
6 0.36
7 0.28
8 0.2
9 0.17
10 0.17
11 0.18
12 0.17
13 0.18
14 0.17
15 0.15
16 0.14
17 0.14
18 0.13
19 0.12
20 0.13
21 0.14
22 0.14
23 0.14
24 0.14
25 0.13
26 0.12
27 0.11
28 0.11
29 0.09
30 0.09
31 0.08
32 0.08
33 0.08
34 0.09
35 0.11
36 0.11
37 0.13
38 0.21
39 0.28
40 0.3
41 0.34
42 0.41
43 0.47
44 0.54
45 0.6
46 0.63
47 0.66
48 0.72
49 0.79
50 0.82
51 0.83
52 0.85
53 0.86
54 0.83
55 0.82