Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JU92

Protein Details
Accession A0A197JU92    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
61-85KSNFGSKKTCKNRRKSHTGNAVRTKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 10, plas 4, nucl 3.5, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSMKQSGRRKAKSTYHFSFTFTHFLSLLSRIIIFFLLLSIIPLLTLRIHMCQKKNEASNAKSNFGSKKTCKNRRKSHTGNAVRTKKMYSSKRGEGGGEVQQSARQYKAEMRGKSGKPDTSNRPSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.68
3 0.61
4 0.6
5 0.54
6 0.47
7 0.43
8 0.34
9 0.3
10 0.23
11 0.23
12 0.22
13 0.2
14 0.17
15 0.12
16 0.12
17 0.1
18 0.1
19 0.09
20 0.08
21 0.05
22 0.05
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.06
33 0.06
34 0.1
35 0.15
36 0.2
37 0.23
38 0.27
39 0.32
40 0.36
41 0.38
42 0.42
43 0.43
44 0.41
45 0.47
46 0.45
47 0.42
48 0.37
49 0.36
50 0.32
51 0.29
52 0.32
53 0.26
54 0.34
55 0.43
56 0.53
57 0.6
58 0.68
59 0.75
60 0.78
61 0.85
62 0.82
63 0.81
64 0.81
65 0.82
66 0.8
67 0.8
68 0.77
69 0.69
70 0.63
71 0.54
72 0.49
73 0.49
74 0.47
75 0.45
76 0.47
77 0.51
78 0.54
79 0.54
80 0.49
81 0.42
82 0.39
83 0.36
84 0.3
85 0.24
86 0.2
87 0.21
88 0.22
89 0.22
90 0.19
91 0.14
92 0.15
93 0.2
94 0.3
95 0.37
96 0.36
97 0.42
98 0.51
99 0.53
100 0.6
101 0.6
102 0.56
103 0.54
104 0.61
105 0.63