Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197K1Z2

Protein Details
Accession A0A197K1Z2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
31-52GGAAKEKKNKPKPAKAEKVTKSBasic
NLS Segment(s)
PositionSequence
33-51AAKEKKNKPKPAKAEKVTK
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
Amino Acid Sequences MPPKRKNSEIAVGDKQSPAKTAKTATTTAAGGAAKEKKNKPKPAKAEKVTKSQAKAAAADLEAKANTVAPWSVRLGRRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.43
3 0.34
4 0.31
5 0.26
6 0.22
7 0.22
8 0.23
9 0.25
10 0.26
11 0.27
12 0.25
13 0.25
14 0.22
15 0.2
16 0.19
17 0.15
18 0.11
19 0.14
20 0.18
21 0.18
22 0.25
23 0.3
24 0.38
25 0.47
26 0.57
27 0.61
28 0.66
29 0.73
30 0.77
31 0.83
32 0.79
33 0.8
34 0.74
35 0.74
36 0.72
37 0.66
38 0.57
39 0.51
40 0.49
41 0.4
42 0.37
43 0.3
44 0.25
45 0.21
46 0.21
47 0.17
48 0.15
49 0.14
50 0.13
51 0.12
52 0.1
53 0.09
54 0.09
55 0.1
56 0.09
57 0.12
58 0.15
59 0.23