Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D5U3

Protein Details
Accession J9D5U3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-54FKIYKYVRIKMHRYRKNKNKNRMITIFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 10, cyto 2
Family & Domain DBs
Amino Acid Sequences MEILIQIAYQKSHHLKFHTQTMLVENKFKIYKYVRIKMHRYRKNKNKNRMITIFNKSEGTTIPLYHIFSISHINTFLNRSMDYGAFYKYYIRNVFIFENRKILRKFRLYIFLICEEFLFSKFFLKYLQNLQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.44
3 0.47
4 0.56
5 0.53
6 0.47
7 0.43
8 0.44
9 0.46
10 0.4
11 0.4
12 0.31
13 0.31
14 0.31
15 0.3
16 0.31
17 0.27
18 0.35
19 0.4
20 0.49
21 0.52
22 0.59
23 0.68
24 0.71
25 0.78
26 0.77
27 0.78
28 0.8
29 0.83
30 0.86
31 0.88
32 0.88
33 0.88
34 0.86
35 0.85
36 0.79
37 0.74
38 0.7
39 0.66
40 0.57
41 0.48
42 0.41
43 0.33
44 0.29
45 0.23
46 0.19
47 0.14
48 0.12
49 0.12
50 0.12
51 0.12
52 0.12
53 0.12
54 0.09
55 0.09
56 0.13
57 0.11
58 0.11
59 0.1
60 0.11
61 0.11
62 0.13
63 0.14
64 0.11
65 0.11
66 0.12
67 0.13
68 0.13
69 0.14
70 0.13
71 0.12
72 0.11
73 0.11
74 0.15
75 0.14
76 0.2
77 0.19
78 0.21
79 0.2
80 0.23
81 0.26
82 0.29
83 0.33
84 0.29
85 0.36
86 0.35
87 0.41
88 0.41
89 0.43
90 0.45
91 0.46
92 0.49
93 0.45
94 0.53
95 0.49
96 0.5
97 0.49
98 0.45
99 0.39
100 0.35
101 0.3
102 0.24
103 0.22
104 0.19
105 0.16
106 0.12
107 0.16
108 0.16
109 0.16
110 0.18
111 0.2
112 0.24