Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JHJ2

Protein Details
Accession A0A197JHJ2    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
68-100TPLLQKRTTRLLRKPRRVKRRRRTRTKPRRRGEBasic
NLS Segment(s)
PositionSequence
76-100TRLLRKPRRVKRRRRTRTKPRRRGE
Subcellular Location(s) extr 17, nucl 4, mito 3, plas 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MRLITIGLGACALFVLSTVQAQEAAAAPPTPPTSAAAEDELVISAEALKKKSSTPHSQNLSHAFISLTPLLQKRTTRLLRKPRRVKRRRRTRTKPRRRGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.05
3 0.05
4 0.05
5 0.06
6 0.06
7 0.06
8 0.07
9 0.07
10 0.07
11 0.07
12 0.07
13 0.07
14 0.07
15 0.09
16 0.1
17 0.1
18 0.09
19 0.11
20 0.12
21 0.13
22 0.15
23 0.14
24 0.13
25 0.13
26 0.12
27 0.1
28 0.08
29 0.06
30 0.05
31 0.04
32 0.07
33 0.08
34 0.09
35 0.09
36 0.09
37 0.11
38 0.17
39 0.23
40 0.29
41 0.35
42 0.42
43 0.47
44 0.49
45 0.52
46 0.5
47 0.47
48 0.38
49 0.32
50 0.23
51 0.18
52 0.19
53 0.15
54 0.11
55 0.11
56 0.13
57 0.15
58 0.19
59 0.2
60 0.21
61 0.3
62 0.39
63 0.45
64 0.53
65 0.62
66 0.69
67 0.79
68 0.86
69 0.87
70 0.9
71 0.92
72 0.94
73 0.94
74 0.94
75 0.94
76 0.95
77 0.96
78 0.96
79 0.97
80 0.97