Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JB21

Protein Details
Accession A0A197JB21    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
82-111ILNSLRKIRIDPRKKSKKPFLSKKHQQERLHydrophilic
NLS Segment(s)
PositionSequence
87-106RKIRIDPRKKSKKPFLSKKH
Subcellular Location(s) mito 21, nucl 4.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002492  Transposase_Tc1-like  
Gene Ontology GO:0003677  F:DNA binding  
GO:0015074  P:DNA integration  
GO:0006313  P:DNA transposition  
Pfam View protein in Pfam  
PF01498  HTH_Tnp_Tc3_2  
Amino Acid Sequences LQKQQSISGVAKAVGVNKATVSRLKNTFLPTLPRQASGRPCILSDVKLRQINRNVLKGDCTTGRDVHKRLQQEGIQISYQTILNSLRKIRIDPRKKSKKPFLSKKHQQERL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.15
4 0.15
5 0.16
6 0.17
7 0.21
8 0.21
9 0.25
10 0.27
11 0.3
12 0.32
13 0.34
14 0.36
15 0.34
16 0.38
17 0.34
18 0.4
19 0.38
20 0.37
21 0.34
22 0.35
23 0.39
24 0.36
25 0.36
26 0.28
27 0.27
28 0.28
29 0.28
30 0.26
31 0.25
32 0.25
33 0.28
34 0.31
35 0.32
36 0.34
37 0.39
38 0.45
39 0.44
40 0.43
41 0.38
42 0.35
43 0.36
44 0.3
45 0.27
46 0.2
47 0.18
48 0.16
49 0.18
50 0.22
51 0.25
52 0.27
53 0.31
54 0.34
55 0.34
56 0.35
57 0.37
58 0.34
59 0.34
60 0.34
61 0.31
62 0.27
63 0.24
64 0.22
65 0.18
66 0.17
67 0.11
68 0.11
69 0.12
70 0.14
71 0.17
72 0.2
73 0.23
74 0.24
75 0.27
76 0.35
77 0.43
78 0.51
79 0.58
80 0.67
81 0.73
82 0.81
83 0.88
84 0.89
85 0.89
86 0.91
87 0.91
88 0.91
89 0.91
90 0.93
91 0.94