Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197K9P1

Protein Details
Accession A0A197K9P1    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
60-87EEGCGVCKRRKKDRRKGRKGEEDVDKGKBasic
NLS Segment(s)
PositionSequence
67-79KRRKKDRRKGRKG
Subcellular Location(s) extr 6, cyto_nucl 5, nucl 4.5, cyto 4.5, E.R. 4, mito 3, plas 2, golg 2
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MVFVKMRAFVVCDAGCCCLCCGVCSCMRDLSDYDLERTRIGIGAFEVNAIDRYGLTKKEEEGCGVCKRRKKDRRKGRKGEEDVDKGKDWGLDWKGKGDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.19
4 0.18
5 0.15
6 0.15
7 0.15
8 0.17
9 0.17
10 0.22
11 0.22
12 0.23
13 0.24
14 0.24
15 0.25
16 0.22
17 0.24
18 0.25
19 0.25
20 0.25
21 0.24
22 0.25
23 0.23
24 0.22
25 0.17
26 0.13
27 0.12
28 0.1
29 0.08
30 0.08
31 0.08
32 0.07
33 0.07
34 0.06
35 0.06
36 0.06
37 0.05
38 0.04
39 0.06
40 0.07
41 0.09
42 0.11
43 0.11
44 0.13
45 0.17
46 0.18
47 0.17
48 0.18
49 0.21
50 0.27
51 0.33
52 0.35
53 0.37
54 0.43
55 0.52
56 0.61
57 0.68
58 0.71
59 0.76
60 0.84
61 0.9
62 0.94
63 0.93
64 0.94
65 0.91
66 0.88
67 0.86
68 0.82
69 0.74
70 0.68
71 0.58
72 0.47
73 0.41
74 0.34
75 0.25
76 0.26
77 0.28
78 0.3
79 0.3