Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DP62

Protein Details
Accession J9DP62   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
166-190ECNFTDKNKVSHRRKALKKLEDFLKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16, cyto_nucl 13.5, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002637  Ham1p-like  
IPR029001  ITPase-like_fam  
Gene Ontology GO:0047429  F:nucleoside triphosphate diphosphatase activity  
GO:0009143  P:nucleoside triphosphate catabolic process  
Pfam View protein in Pfam  
PF01725  Ham1p_like  
CDD cd00515  HAM1  
Amino Acid Sequences MIYFFATSNKHKFEEAKDILTVPLIAENVDITEIQGSIEDIVIKKAIDAYGIIKPRYPEPICVITDDVSLEIKMLNNFPGVYVKEFISNGFENLEKILNIHDKSATAICAIGICYDSPGQTQSYTTKCFKAVVNGQLTFNRPIHNVNAFGFDKIFVPDGMEKTYAECNFTDKNKVSHRRKALKKLEDFLKIQDFCNSINKKKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.42
4 0.39
5 0.38
6 0.35
7 0.31
8 0.26
9 0.15
10 0.13
11 0.1
12 0.09
13 0.08
14 0.08
15 0.07
16 0.08
17 0.07
18 0.06
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.06
26 0.07
27 0.07
28 0.08
29 0.09
30 0.08
31 0.08
32 0.09
33 0.09
34 0.08
35 0.08
36 0.1
37 0.16
38 0.2
39 0.2
40 0.2
41 0.22
42 0.23
43 0.31
44 0.29
45 0.27
46 0.28
47 0.33
48 0.32
49 0.33
50 0.32
51 0.24
52 0.23
53 0.2
54 0.15
55 0.1
56 0.09
57 0.07
58 0.07
59 0.07
60 0.07
61 0.08
62 0.08
63 0.08
64 0.08
65 0.08
66 0.11
67 0.11
68 0.12
69 0.12
70 0.12
71 0.13
72 0.13
73 0.13
74 0.14
75 0.13
76 0.12
77 0.12
78 0.11
79 0.1
80 0.1
81 0.11
82 0.06
83 0.06
84 0.08
85 0.11
86 0.12
87 0.12
88 0.12
89 0.11
90 0.12
91 0.13
92 0.11
93 0.07
94 0.06
95 0.06
96 0.06
97 0.06
98 0.05
99 0.05
100 0.04
101 0.05
102 0.06
103 0.06
104 0.06
105 0.07
106 0.08
107 0.08
108 0.09
109 0.12
110 0.15
111 0.2
112 0.21
113 0.22
114 0.22
115 0.24
116 0.23
117 0.26
118 0.29
119 0.31
120 0.34
121 0.33
122 0.34
123 0.34
124 0.37
125 0.33
126 0.28
127 0.23
128 0.19
129 0.2
130 0.23
131 0.23
132 0.22
133 0.19
134 0.25
135 0.24
136 0.23
137 0.21
138 0.18
139 0.16
140 0.15
141 0.15
142 0.09
143 0.11
144 0.14
145 0.15
146 0.17
147 0.17
148 0.16
149 0.17
150 0.23
151 0.21
152 0.2
153 0.19
154 0.21
155 0.25
156 0.28
157 0.33
158 0.3
159 0.37
160 0.45
161 0.56
162 0.6
163 0.64
164 0.73
165 0.76
166 0.82
167 0.86
168 0.86
169 0.86
170 0.85
171 0.83
172 0.8
173 0.76
174 0.68
175 0.63
176 0.61
177 0.53
178 0.46
179 0.43
180 0.37
181 0.33
182 0.41
183 0.42