Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197K9L4

Protein Details
Accession A0A197K9L4    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-39MVRGMVKEVKKKEKRTRGRGRERKRGVERKKKGEEKEKVBasic
NLS Segment(s)
PositionSequence
8-36EVKKKEKRTRGRGRERKRGVERKKKGEEK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MVRGMVKEVKKKEKRTRGRGRERKRGVERKKKGEEKEKVDNASDFSGTLLYVSKKDSKSEGGERERENCRVLHLPRQQNQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.91
4 0.91
5 0.94
6 0.94
7 0.93
8 0.93
9 0.9
10 0.89
11 0.88
12 0.88
13 0.87
14 0.88
15 0.87
16 0.86
17 0.88
18 0.85
19 0.82
20 0.82
21 0.79
22 0.75
23 0.75
24 0.69
25 0.61
26 0.54
27 0.47
28 0.38
29 0.3
30 0.23
31 0.14
32 0.1
33 0.08
34 0.07
35 0.07
36 0.07
37 0.06
38 0.07
39 0.1
40 0.16
41 0.17
42 0.19
43 0.21
44 0.23
45 0.29
46 0.36
47 0.42
48 0.43
49 0.48
50 0.48
51 0.52
52 0.53
53 0.49
54 0.44
55 0.35
56 0.34
57 0.37
58 0.38
59 0.42
60 0.47
61 0.54