Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197K863

Protein Details
Accession A0A197K863    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
80-115FVSCSKSRKYKERKERKEERRERRKRERADNEAKNEBasic
NLS Segment(s)
PositionSequence
85-109KSRKYKERKERKEERRERRKRERAD
Subcellular Location(s) nucl 10, mito 9.5, cyto_mito 8, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MNKTKQNITDRFPSFHFVSSFHALPCCSHHIVPRAALFVAPHALPPAPHCSLMLDCIISHPNRVSGYSHIMSSSLSLSLFVSCSKSRKYKERKERKEERRERRKRERADNEAKNEHRRESTHTLCLFMQATTTRIRFFISFLSTFKMDLSRSVCLSVCLCVFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.37
4 0.29
5 0.31
6 0.33
7 0.32
8 0.27
9 0.27
10 0.23
11 0.23
12 0.25
13 0.25
14 0.23
15 0.24
16 0.28
17 0.32
18 0.34
19 0.36
20 0.34
21 0.3
22 0.26
23 0.25
24 0.2
25 0.15
26 0.15
27 0.12
28 0.1
29 0.1
30 0.1
31 0.1
32 0.12
33 0.16
34 0.16
35 0.16
36 0.16
37 0.17
38 0.17
39 0.19
40 0.17
41 0.11
42 0.09
43 0.1
44 0.14
45 0.12
46 0.13
47 0.11
48 0.13
49 0.13
50 0.15
51 0.15
52 0.14
53 0.2
54 0.19
55 0.19
56 0.16
57 0.16
58 0.14
59 0.13
60 0.11
61 0.06
62 0.05
63 0.05
64 0.06
65 0.06
66 0.06
67 0.06
68 0.08
69 0.09
70 0.11
71 0.15
72 0.21
73 0.25
74 0.35
75 0.45
76 0.53
77 0.63
78 0.73
79 0.79
80 0.83
81 0.9
82 0.9
83 0.92
84 0.91
85 0.91
86 0.91
87 0.91
88 0.91
89 0.92
90 0.91
91 0.88
92 0.89
93 0.88
94 0.87
95 0.87
96 0.84
97 0.8
98 0.79
99 0.74
100 0.71
101 0.64
102 0.56
103 0.49
104 0.43
105 0.44
106 0.44
107 0.44
108 0.44
109 0.42
110 0.42
111 0.38
112 0.39
113 0.32
114 0.23
115 0.21
116 0.14
117 0.15
118 0.18
119 0.19
120 0.17
121 0.17
122 0.19
123 0.17
124 0.17
125 0.2
126 0.2
127 0.21
128 0.22
129 0.26
130 0.24
131 0.24
132 0.24
133 0.22
134 0.18
135 0.21
136 0.24
137 0.23
138 0.24
139 0.26
140 0.25
141 0.24
142 0.24
143 0.22