Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D6M2

Protein Details
Accession J9D6M2   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPVKRRNHGRAKKNRGHTDFQRCDBasic
NLS Segment(s)
PositionSequence
5-14RRNHGRAKKN
87-98RSVEKRKLRGAA
Subcellular Location(s) nucl 15, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MPVKRRNHGRAKKNRGHTDFQRCDNCHRACPKDKAIKRYQVRNVIEAAAADDLKLAILIENFEIPKSFDKSVLCISCAVHKRVVRSRSVEKRKLRGAAARAAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.85
3 0.84
4 0.82
5 0.82
6 0.78
7 0.76
8 0.75
9 0.66
10 0.66
11 0.67
12 0.6
13 0.56
14 0.56
15 0.56
16 0.55
17 0.6
18 0.62
19 0.64
20 0.66
21 0.67
22 0.69
23 0.71
24 0.69
25 0.71
26 0.69
27 0.68
28 0.65
29 0.58
30 0.51
31 0.41
32 0.36
33 0.26
34 0.19
35 0.1
36 0.08
37 0.07
38 0.05
39 0.04
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.03
46 0.04
47 0.05
48 0.05
49 0.06
50 0.06
51 0.07
52 0.1
53 0.14
54 0.14
55 0.16
56 0.17
57 0.2
58 0.26
59 0.26
60 0.23
61 0.21
62 0.21
63 0.26
64 0.3
65 0.3
66 0.3
67 0.3
68 0.37
69 0.44
70 0.48
71 0.46
72 0.48
73 0.56
74 0.61
75 0.7
76 0.72
77 0.72
78 0.76
79 0.78
80 0.77
81 0.72
82 0.69
83 0.63