Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197KCR3

Protein Details
Accession A0A197KCR3    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
72-91DFLDREKAKHQAKKNAERIYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 6.5, cyto_nucl 5.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022234  DUF3759  
Pfam View protein in Pfam  
PF12585  DUF3759  
Amino Acid Sequences MFGFGEHHDEVYGSEGHKSSWSHELIAGAAAFEAMKSVENGRPDDKHKLTKEIFAGLAAMEADKLFETKGLDFLDREKAKHQAKKNAERIYEEKYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.13
4 0.16
5 0.17
6 0.17
7 0.22
8 0.22
9 0.21
10 0.22
11 0.22
12 0.18
13 0.19
14 0.15
15 0.09
16 0.07
17 0.06
18 0.05
19 0.04
20 0.04
21 0.03
22 0.04
23 0.04
24 0.07
25 0.09
26 0.12
27 0.14
28 0.16
29 0.19
30 0.22
31 0.29
32 0.3
33 0.36
34 0.35
35 0.4
36 0.38
37 0.39
38 0.37
39 0.31
40 0.27
41 0.2
42 0.18
43 0.11
44 0.11
45 0.07
46 0.05
47 0.04
48 0.03
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.07
55 0.07
56 0.11
57 0.12
58 0.13
59 0.13
60 0.16
61 0.25
62 0.25
63 0.26
64 0.25
65 0.33
66 0.41
67 0.49
68 0.55
69 0.55
70 0.64
71 0.74
72 0.8
73 0.79
74 0.74
75 0.73
76 0.68