Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JER3

Protein Details
Accession A0A197JER3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
230-251VFCLLVRQKKRRTRNTLARENMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9extr 9, plas 6, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR015915  Kelch-typ_b-propeller  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQTIVSSLVTLNPSSGFVPQISAPVSVAPNAPTLARHTMTLTTDGRAIILGGINPQGLLANLTSAYVMDTQSTEAIWKEVPLLGKAPDPRMAFSTVMVNSTTLLLYGGTNDFKSAFWVTFYLDLPTWTWSSPVAQGTIPRRWGHTATMVGKIMVVMFGLSSRQTPDLAPVVLLDTTTNTWISRYTPSDQMVNPGNNNDPTATNGGKKGGLSLIAVLGIGFVFTAGLVIGVFCLLVRQKKRRTRNTLARENMGHHVPRDAIKKQQQDGANPTWGILGRAATRLGFGSSSGTGGGGGYRPESRRLSAISPQEHPMSIAAQMTQSGHPPSSLGYPEMVVEHGTGMVPVSSYIYPNQPLADSESLSRPAPAATVRMSGQGRSMFARARRDEEDGYSALVVYHELSPAQKGALSLSQGKQSSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.14
4 0.12
5 0.15
6 0.14
7 0.17
8 0.17
9 0.17
10 0.16
11 0.17
12 0.18
13 0.17
14 0.18
15 0.15
16 0.16
17 0.16
18 0.16
19 0.14
20 0.18
21 0.23
22 0.22
23 0.22
24 0.22
25 0.25
26 0.27
27 0.31
28 0.28
29 0.23
30 0.24
31 0.23
32 0.2
33 0.17
34 0.15
35 0.1
36 0.1
37 0.09
38 0.09
39 0.1
40 0.1
41 0.09
42 0.09
43 0.08
44 0.07
45 0.08
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.09
58 0.09
59 0.09
60 0.09
61 0.08
62 0.1
63 0.09
64 0.09
65 0.09
66 0.12
67 0.13
68 0.13
69 0.15
70 0.15
71 0.19
72 0.22
73 0.24
74 0.27
75 0.27
76 0.27
77 0.28
78 0.3
79 0.25
80 0.23
81 0.26
82 0.2
83 0.2
84 0.19
85 0.16
86 0.13
87 0.14
88 0.13
89 0.07
90 0.07
91 0.06
92 0.06
93 0.07
94 0.09
95 0.09
96 0.09
97 0.1
98 0.1
99 0.1
100 0.13
101 0.13
102 0.11
103 0.11
104 0.12
105 0.12
106 0.14
107 0.15
108 0.14
109 0.13
110 0.13
111 0.13
112 0.14
113 0.14
114 0.12
115 0.12
116 0.1
117 0.12
118 0.14
119 0.14
120 0.13
121 0.13
122 0.19
123 0.23
124 0.27
125 0.3
126 0.27
127 0.29
128 0.3
129 0.31
130 0.28
131 0.28
132 0.3
133 0.27
134 0.31
135 0.28
136 0.25
137 0.23
138 0.21
139 0.16
140 0.1
141 0.07
142 0.03
143 0.03
144 0.03
145 0.04
146 0.04
147 0.05
148 0.06
149 0.07
150 0.08
151 0.08
152 0.11
153 0.12
154 0.12
155 0.11
156 0.1
157 0.1
158 0.09
159 0.09
160 0.06
161 0.05
162 0.06
163 0.07
164 0.07
165 0.06
166 0.07
167 0.07
168 0.09
169 0.12
170 0.15
171 0.17
172 0.21
173 0.22
174 0.25
175 0.24
176 0.26
177 0.26
178 0.24
179 0.22
180 0.19
181 0.2
182 0.17
183 0.18
184 0.15
185 0.11
186 0.11
187 0.14
188 0.14
189 0.13
190 0.13
191 0.14
192 0.14
193 0.13
194 0.12
195 0.09
196 0.09
197 0.08
198 0.07
199 0.06
200 0.05
201 0.05
202 0.04
203 0.04
204 0.03
205 0.03
206 0.02
207 0.02
208 0.02
209 0.02
210 0.02
211 0.02
212 0.02
213 0.02
214 0.02
215 0.02
216 0.02
217 0.02
218 0.02
219 0.03
220 0.05
221 0.1
222 0.16
223 0.25
224 0.35
225 0.44
226 0.55
227 0.64
228 0.72
229 0.78
230 0.83
231 0.84
232 0.85
233 0.79
234 0.73
235 0.64
236 0.57
237 0.49
238 0.41
239 0.32
240 0.23
241 0.21
242 0.18
243 0.21
244 0.23
245 0.22
246 0.27
247 0.34
248 0.39
249 0.4
250 0.45
251 0.43
252 0.42
253 0.47
254 0.43
255 0.38
256 0.32
257 0.3
258 0.25
259 0.23
260 0.19
261 0.13
262 0.11
263 0.1
264 0.11
265 0.11
266 0.1
267 0.1
268 0.1
269 0.1
270 0.08
271 0.07
272 0.08
273 0.08
274 0.09
275 0.08
276 0.08
277 0.07
278 0.07
279 0.07
280 0.06
281 0.06
282 0.07
283 0.11
284 0.12
285 0.18
286 0.2
287 0.21
288 0.23
289 0.25
290 0.28
291 0.31
292 0.37
293 0.35
294 0.36
295 0.37
296 0.36
297 0.33
298 0.3
299 0.24
300 0.17
301 0.15
302 0.13
303 0.1
304 0.09
305 0.1
306 0.11
307 0.11
308 0.13
309 0.14
310 0.13
311 0.13
312 0.13
313 0.14
314 0.15
315 0.16
316 0.14
317 0.13
318 0.13
319 0.13
320 0.14
321 0.13
322 0.1
323 0.08
324 0.08
325 0.07
326 0.07
327 0.06
328 0.06
329 0.05
330 0.05
331 0.05
332 0.07
333 0.08
334 0.09
335 0.11
336 0.15
337 0.17
338 0.18
339 0.18
340 0.16
341 0.17
342 0.22
343 0.22
344 0.19
345 0.2
346 0.22
347 0.24
348 0.24
349 0.23
350 0.17
351 0.15
352 0.16
353 0.15
354 0.15
355 0.15
356 0.17
357 0.18
358 0.24
359 0.25
360 0.23
361 0.27
362 0.26
363 0.26
364 0.25
365 0.28
366 0.27
367 0.31
368 0.41
369 0.39
370 0.43
371 0.45
372 0.47
373 0.47
374 0.45
375 0.44
376 0.35
377 0.33
378 0.27
379 0.23
380 0.18
381 0.15
382 0.12
383 0.09
384 0.1
385 0.09
386 0.1
387 0.11
388 0.13
389 0.13
390 0.13
391 0.13
392 0.12
393 0.15
394 0.18
395 0.21
396 0.26
397 0.28
398 0.34