Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JLB0

Protein Details
Accession A0A197JLB0    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-45PKVAKQEKKKKLTGRAKKRDTYKRRFBasic
NLS Segment(s)
PositionSequence
12-44AGKVKSQTPKVAKQEKKKKLTGRAKKRDTYKRR
Subcellular Location(s) nucl 12.5, mito_nucl 11.5, mito 9.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MSGKVHGSLARAGKVKSQTPKVAKQEKKKKLTGRAKKRDTYKRRFVNVTNAPGGKRRMNVNPESTKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.39
3 0.41
4 0.44
5 0.48
6 0.51
7 0.59
8 0.63
9 0.69
10 0.7
11 0.73
12 0.78
13 0.79
14 0.8
15 0.78
16 0.76
17 0.77
18 0.8
19 0.8
20 0.8
21 0.81
22 0.81
23 0.79
24 0.82
25 0.82
26 0.81
27 0.8
28 0.79
29 0.77
30 0.75
31 0.74
32 0.67
33 0.67
34 0.64
35 0.6
36 0.56
37 0.48
38 0.44
39 0.44
40 0.46
41 0.4
42 0.35
43 0.36
44 0.39
45 0.45
46 0.5
47 0.54