Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DQS1

Protein Details
Accession J9DQS1   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAVAQKKKRNTKEYENSKILNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043141  Ribosomal_L10-like_sf  
IPR001790  Ribosomal_L10P  
IPR043164  RL10_insert_sf  
IPR040637  RL10P_insert  
Pfam View protein in Pfam  
PF00466  Ribosomal_L10  
PF17777  RL10P_insert  
Amino Acid Sequences MAVAQKKKRNTKEYENSKILNLTKEYKNLLLVEATDQRSSFLQKLRDLVRVDSKIIFGKRKMLIKSLEATKISKINKLTTKMAGSFFLLFTNRDAQEMVKFISEIEVKGFLRPNEICSEDIVLPSGIVKINDSDVPVDFEKVLRRFNVPVVIQQGKVICQEEYKICEKDRKIDVSQSKLLRMFGYELAVLKLKVLEVFLFNEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.81
3 0.73
4 0.66
5 0.63
6 0.54
7 0.49
8 0.42
9 0.39
10 0.36
11 0.39
12 0.4
13 0.36
14 0.36
15 0.31
16 0.28
17 0.23
18 0.2
19 0.2
20 0.23
21 0.24
22 0.22
23 0.21
24 0.21
25 0.21
26 0.24
27 0.24
28 0.23
29 0.26
30 0.27
31 0.33
32 0.34
33 0.39
34 0.38
35 0.37
36 0.41
37 0.37
38 0.37
39 0.33
40 0.31
41 0.3
42 0.32
43 0.33
44 0.25
45 0.31
46 0.34
47 0.39
48 0.39
49 0.38
50 0.37
51 0.35
52 0.4
53 0.36
54 0.36
55 0.31
56 0.31
57 0.28
58 0.31
59 0.3
60 0.28
61 0.26
62 0.29
63 0.33
64 0.36
65 0.37
66 0.34
67 0.35
68 0.33
69 0.31
70 0.26
71 0.21
72 0.18
73 0.15
74 0.13
75 0.12
76 0.1
77 0.1
78 0.14
79 0.13
80 0.13
81 0.13
82 0.12
83 0.13
84 0.13
85 0.12
86 0.08
87 0.08
88 0.07
89 0.1
90 0.09
91 0.08
92 0.08
93 0.1
94 0.1
95 0.12
96 0.14
97 0.12
98 0.16
99 0.16
100 0.17
101 0.17
102 0.19
103 0.18
104 0.16
105 0.19
106 0.15
107 0.14
108 0.13
109 0.1
110 0.08
111 0.08
112 0.08
113 0.06
114 0.06
115 0.07
116 0.06
117 0.08
118 0.09
119 0.09
120 0.09
121 0.09
122 0.12
123 0.12
124 0.13
125 0.11
126 0.12
127 0.18
128 0.19
129 0.21
130 0.19
131 0.21
132 0.22
133 0.24
134 0.3
135 0.24
136 0.26
137 0.3
138 0.31
139 0.28
140 0.28
141 0.27
142 0.21
143 0.23
144 0.21
145 0.15
146 0.13
147 0.17
148 0.18
149 0.22
150 0.26
151 0.27
152 0.28
153 0.35
154 0.36
155 0.41
156 0.45
157 0.46
158 0.45
159 0.51
160 0.56
161 0.55
162 0.61
163 0.55
164 0.53
165 0.49
166 0.46
167 0.37
168 0.32
169 0.28
170 0.22
171 0.22
172 0.18
173 0.17
174 0.18
175 0.19
176 0.17
177 0.15
178 0.14
179 0.12
180 0.12
181 0.12
182 0.11
183 0.12