Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JT81

Protein Details
Accession A0A197JT81    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-47HQGPDRRPQRWSQRQRQRQRRHQQQHGQQHRYLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MAQPLYSPVCVGRCHQGPDRRPQRWSQRQRQRQRRHQQQHGQQHRYLRARLSQRPASIAQPTSLHPTRIREGQEGERRKASAEEAEEERL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.39
3 0.46
4 0.48
5 0.58
6 0.66
7 0.63
8 0.62
9 0.65
10 0.69
11 0.71
12 0.76
13 0.76
14 0.77
15 0.83
16 0.91
17 0.93
18 0.93
19 0.93
20 0.93
21 0.93
22 0.92
23 0.91
24 0.9
25 0.88
26 0.88
27 0.88
28 0.81
29 0.72
30 0.67
31 0.64
32 0.57
33 0.49
34 0.4
35 0.36
36 0.38
37 0.42
38 0.44
39 0.42
40 0.39
41 0.41
42 0.41
43 0.37
44 0.34
45 0.29
46 0.23
47 0.2
48 0.21
49 0.26
50 0.26
51 0.26
52 0.24
53 0.28
54 0.3
55 0.34
56 0.36
57 0.32
58 0.35
59 0.42
60 0.5
61 0.52
62 0.52
63 0.51
64 0.48
65 0.46
66 0.43
67 0.36
68 0.33
69 0.3
70 0.31