Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9DH15

Protein Details
Accession J9DH15    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
75-99FYQIYKKRKICSNKENKKSNSNTFSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 8, mito 7, E.R. 7, extr 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYTEIVKAINLTVKFFILFKSFIIRLLISIFVWILKHIMSFIKNILISKNIKWNAFLSNEMRMLAGYCCCKYTSFYQIYKKRKICSNKENKKSNSNTFSFLYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.14
5 0.15
6 0.13
7 0.18
8 0.17
9 0.18
10 0.2
11 0.18
12 0.16
13 0.17
14 0.17
15 0.11
16 0.11
17 0.09
18 0.08
19 0.08
20 0.07
21 0.06
22 0.05
23 0.05
24 0.06
25 0.08
26 0.08
27 0.09
28 0.09
29 0.12
30 0.12
31 0.12
32 0.12
33 0.14
34 0.15
35 0.16
36 0.23
37 0.23
38 0.23
39 0.24
40 0.24
41 0.23
42 0.23
43 0.24
44 0.17
45 0.18
46 0.18
47 0.17
48 0.16
49 0.13
50 0.12
51 0.11
52 0.11
53 0.11
54 0.11
55 0.12
56 0.13
57 0.14
58 0.16
59 0.19
60 0.25
61 0.3
62 0.36
63 0.45
64 0.53
65 0.61
66 0.68
67 0.69
68 0.67
69 0.69
70 0.73
71 0.73
72 0.75
73 0.78
74 0.79
75 0.83
76 0.88
77 0.85
78 0.85
79 0.83
80 0.81
81 0.78
82 0.7
83 0.65