Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197KF69

Protein Details
Accession A0A197KF69   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MHIENQQKKKKNRSILPSVMHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 7, E.R. 5, extr 2, golg 2
Family & Domain DBs
Amino Acid Sequences MHIENQQKKKKNRSILPSVMPSLIFLFSLVQFLLSSPPLLSPSFILTPSPHPSIPFLFIAPSVRST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.77
4 0.7
5 0.62
6 0.53
7 0.43
8 0.35
9 0.26
10 0.19
11 0.13
12 0.09
13 0.08
14 0.07
15 0.08
16 0.07
17 0.06
18 0.05
19 0.05
20 0.06
21 0.06
22 0.06
23 0.05
24 0.06
25 0.08
26 0.08
27 0.08
28 0.08
29 0.11
30 0.11
31 0.12
32 0.12
33 0.12
34 0.17
35 0.22
36 0.24
37 0.22
38 0.22
39 0.25
40 0.26
41 0.28
42 0.24
43 0.2
44 0.17
45 0.18
46 0.21