Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D132

Protein Details
Accession J9D132   
Localization Confidence High
Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MVNIPKKRKTHCSKCNLHTEHKHydrophilic
51-91QTKPILRRKCKVTKKPVLKLECSTCKTKKMKVLKRAKHVELHydrophilic
NLS Segment(s)
PositionSequence
36-47QGARRYARKQRG
56-59LRRK
79-87KMKVLKRAK
Subcellular Location(s) nucl 15, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKKRKTHCSKCNLHTEHKVSIYKKGKENTVKQGARRYARKQRGYQGQTKPILRRKCKVTKKPVLKLECSTCKTKKMKVLKRAKHVELGGEKKVKGEALVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.87
3 0.82
4 0.78
5 0.76
6 0.71
7 0.65
8 0.61
9 0.6
10 0.51
11 0.55
12 0.56
13 0.53
14 0.55
15 0.53
16 0.56
17 0.58
18 0.63
19 0.63
20 0.64
21 0.62
22 0.59
23 0.63
24 0.62
25 0.6
26 0.61
27 0.59
28 0.59
29 0.66
30 0.7
31 0.66
32 0.68
33 0.71
34 0.69
35 0.69
36 0.65
37 0.63
38 0.6
39 0.59
40 0.57
41 0.54
42 0.58
43 0.54
44 0.53
45 0.54
46 0.6
47 0.68
48 0.71
49 0.74
50 0.76
51 0.81
52 0.84
53 0.84
54 0.79
55 0.72
56 0.67
57 0.65
58 0.63
59 0.57
60 0.55
61 0.49
62 0.53
63 0.54
64 0.55
65 0.56
66 0.58
67 0.64
68 0.68
69 0.76
70 0.76
71 0.82
72 0.85
73 0.79
74 0.75
75 0.66
76 0.63
77 0.61
78 0.58
79 0.55
80 0.51
81 0.47
82 0.41
83 0.42
84 0.35