Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179FWZ3

Protein Details
Accession A0A179FWZ3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
91-117RTDWPDPPAKFKGRRRRKNQPQEKGGEBasic
NLS Segment(s)
PositionSequence
98-113PAKFKGRRRRKNQPQE
Subcellular Location(s) extr 19, mito 5, plas 1, E.R. 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MKISLVLASLTVLGSAVAQTTAAAAPTGEVMGQCSRSFGPKYPWGSCLLPGHKRVACSKSSRCPIGPFGKWNCKLPEGKTEAECKPAHWRRTDWPDPPAKFKGRRRRKNQPQEKGGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.04
17 0.06
18 0.08
19 0.1
20 0.1
21 0.11
22 0.12
23 0.15
24 0.18
25 0.18
26 0.23
27 0.28
28 0.34
29 0.34
30 0.35
31 0.35
32 0.34
33 0.35
34 0.35
35 0.33
36 0.32
37 0.32
38 0.36
39 0.32
40 0.33
41 0.34
42 0.31
43 0.29
44 0.31
45 0.34
46 0.37
47 0.4
48 0.4
49 0.37
50 0.36
51 0.39
52 0.4
53 0.37
54 0.36
55 0.38
56 0.46
57 0.47
58 0.48
59 0.45
60 0.42
61 0.43
62 0.39
63 0.41
64 0.37
65 0.38
66 0.36
67 0.39
68 0.36
69 0.39
70 0.36
71 0.29
72 0.36
73 0.41
74 0.44
75 0.43
76 0.46
77 0.48
78 0.58
79 0.64
80 0.58
81 0.58
82 0.62
83 0.61
84 0.64
85 0.62
86 0.61
87 0.63
88 0.68
89 0.71
90 0.73
91 0.81
92 0.84
93 0.88
94 0.91
95 0.93
96 0.94
97 0.94