Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9DNR4

Protein Details
Accession J9DNR4    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
17-45SNKYVIKKVNGKQRVRKLKKRGKATSCGDHydrophilic
NLS Segment(s)
PositionSequence
23-40KKVNGKQRVRKLKKRGKA
54-69SAKRPAAFKRLKKSKR
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
Amino Acid Sequences MTKPTTLPGRQSYITRSNKYVIKKVNGKQRVRKLKKRGKATSCGDCKKTLAGISAKRPAAFKRLKKSKRTVARAYGGVLCGKCVETRIITSFLNQEDVIKSKLKGEAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.51
3 0.49
4 0.48
5 0.51
6 0.54
7 0.55
8 0.52
9 0.52
10 0.57
11 0.6
12 0.66
13 0.7
14 0.72
15 0.74
16 0.77
17 0.8
18 0.81
19 0.85
20 0.85
21 0.86
22 0.86
23 0.87
24 0.86
25 0.81
26 0.81
27 0.77
28 0.75
29 0.74
30 0.71
31 0.62
32 0.53
33 0.47
34 0.39
35 0.34
36 0.25
37 0.2
38 0.2
39 0.21
40 0.24
41 0.29
42 0.29
43 0.28
44 0.28
45 0.26
46 0.3
47 0.35
48 0.37
49 0.42
50 0.53
51 0.59
52 0.66
53 0.73
54 0.74
55 0.76
56 0.78
57 0.75
58 0.71
59 0.68
60 0.61
61 0.56
62 0.47
63 0.38
64 0.33
65 0.26
66 0.19
67 0.15
68 0.14
69 0.12
70 0.12
71 0.13
72 0.12
73 0.15
74 0.18
75 0.2
76 0.2
77 0.21
78 0.23
79 0.22
80 0.23
81 0.2
82 0.19
83 0.19
84 0.22
85 0.23
86 0.22
87 0.21
88 0.22