Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DA50

Protein Details
Accession J9DA50    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-48FNRFHSDRYKRVKKAWRKPRGIDNRVRRKLRBasic
NLS Segment(s)
PositionSequence
26-57YKRVKKAWRKPRGIDNRVRRKLRGAIKMPGKR
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 8.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAEPLIQFTKVKKTNMEFNRFHSDRYKRVKKAWRKPRGIDNRVRRKLRGAIKMPGKRYMNSKATLHTLPNGFRNALVSNVKELETLIGQNRFYCATIRHSVGAKKRIAIVNRAKELDIHVTNETARLVVEGKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.58
3 0.64
4 0.56
5 0.57
6 0.65
7 0.58
8 0.56
9 0.55
10 0.52
11 0.52
12 0.61
13 0.64
14 0.59
15 0.68
16 0.76
17 0.78
18 0.82
19 0.84
20 0.84
21 0.82
22 0.82
23 0.84
24 0.85
25 0.82
26 0.81
27 0.81
28 0.81
29 0.82
30 0.8
31 0.7
32 0.64
33 0.64
34 0.63
35 0.61
36 0.55
37 0.53
38 0.6
39 0.64
40 0.61
41 0.6
42 0.54
43 0.45
44 0.45
45 0.46
46 0.4
47 0.38
48 0.36
49 0.31
50 0.33
51 0.32
52 0.28
53 0.22
54 0.2
55 0.18
56 0.2
57 0.19
58 0.16
59 0.14
60 0.16
61 0.13
62 0.15
63 0.15
64 0.13
65 0.13
66 0.14
67 0.14
68 0.13
69 0.12
70 0.1
71 0.08
72 0.09
73 0.11
74 0.12
75 0.12
76 0.13
77 0.14
78 0.14
79 0.14
80 0.14
81 0.13
82 0.17
83 0.21
84 0.23
85 0.24
86 0.26
87 0.32
88 0.38
89 0.42
90 0.38
91 0.36
92 0.39
93 0.42
94 0.42
95 0.45
96 0.48
97 0.49
98 0.53
99 0.53
100 0.47
101 0.43
102 0.43
103 0.42
104 0.34
105 0.28
106 0.25
107 0.24
108 0.24
109 0.25
110 0.22
111 0.14
112 0.12
113 0.1