Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179F556

Protein Details
Accession A0A179F556    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
51-70GGGGWRRRRRRPGREDEEVDBasic
92-120GGGGRKRTRKTIRKIARRTKRSNDEKDDDBasic
NLS Segment(s)
PositionSequence
53-64GGWRRRRRRPGR
91-112GGGGGRKRTRKTIRKIARRTKR
Subcellular Location(s) nucl 15, cyto 6, mito 4
Family & Domain DBs
Amino Acid Sequences MNPNYRYPDSDPRLRGATPQMSTTQRHSRLPPAQYTLLSSICMDGGAGAGGGGGWRRRRRRPGREDEEVDEEVDEEIDEEGGAGGAANGGGGGGGRKRTRKTIRKIARRTKRSNDEKDDDAGGGANGGGGGGRSIEVEGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.45
3 0.42
4 0.42
5 0.35
6 0.35
7 0.36
8 0.36
9 0.39
10 0.42
11 0.44
12 0.41
13 0.44
14 0.45
15 0.49
16 0.53
17 0.55
18 0.52
19 0.48
20 0.46
21 0.42
22 0.42
23 0.36
24 0.29
25 0.25
26 0.2
27 0.14
28 0.12
29 0.11
30 0.08
31 0.05
32 0.04
33 0.04
34 0.03
35 0.03
36 0.02
37 0.02
38 0.03
39 0.04
40 0.07
41 0.13
42 0.21
43 0.27
44 0.35
45 0.46
46 0.57
47 0.67
48 0.74
49 0.79
50 0.8
51 0.81
52 0.77
53 0.69
54 0.63
55 0.53
56 0.42
57 0.31
58 0.24
59 0.16
60 0.12
61 0.08
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.03
80 0.04
81 0.09
82 0.12
83 0.17
84 0.19
85 0.3
86 0.4
87 0.5
88 0.58
89 0.65
90 0.73
91 0.79
92 0.88
93 0.89
94 0.89
95 0.9
96 0.89
97 0.88
98 0.89
99 0.88
100 0.87
101 0.85
102 0.8
103 0.73
104 0.66
105 0.57
106 0.47
107 0.37
108 0.27
109 0.18
110 0.12
111 0.09
112 0.06
113 0.04
114 0.04
115 0.03
116 0.03
117 0.03
118 0.04
119 0.04
120 0.04