Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D8T7

Protein Details
Accession J9D8T7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
24-47NIGGSEKKSKSKRKPFCDPKGIFNHydrophilic
NLS Segment(s)
PositionSequence
30-37KKSKSKRK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MSDKPTKQTKDKASQTGLSATTPNIGGSEKKSKSKRKPFCDPKGIFNADKIKRNLKMYIKKNERFAQCPPQISRDSFDSLAVMALDLSVTLAELAKSLSKRVSKSTVGIEEIKAAVKLHLRGDLQRGCIAYIDQNCSRKSSDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.62
3 0.57
4 0.48
5 0.39
6 0.32
7 0.24
8 0.2
9 0.17
10 0.15
11 0.11
12 0.11
13 0.12
14 0.16
15 0.26
16 0.28
17 0.36
18 0.45
19 0.55
20 0.65
21 0.74
22 0.79
23 0.78
24 0.85
25 0.88
26 0.89
27 0.89
28 0.81
29 0.76
30 0.74
31 0.7
32 0.59
33 0.53
34 0.52
35 0.46
36 0.5
37 0.47
38 0.44
39 0.44
40 0.47
41 0.49
42 0.48
43 0.53
44 0.54
45 0.62
46 0.65
47 0.65
48 0.68
49 0.68
50 0.63
51 0.56
52 0.53
53 0.53
54 0.46
55 0.48
56 0.42
57 0.4
58 0.39
59 0.36
60 0.33
61 0.26
62 0.25
63 0.21
64 0.19
65 0.15
66 0.13
67 0.12
68 0.09
69 0.07
70 0.04
71 0.03
72 0.03
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.03
79 0.03
80 0.03
81 0.04
82 0.07
83 0.07
84 0.09
85 0.14
86 0.17
87 0.19
88 0.24
89 0.29
90 0.29
91 0.31
92 0.36
93 0.34
94 0.34
95 0.33
96 0.29
97 0.25
98 0.23
99 0.21
100 0.16
101 0.13
102 0.12
103 0.14
104 0.17
105 0.17
106 0.21
107 0.22
108 0.24
109 0.32
110 0.34
111 0.33
112 0.33
113 0.32
114 0.27
115 0.26
116 0.25
117 0.24
118 0.24
119 0.28
120 0.32
121 0.37
122 0.37
123 0.39