Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D885

Protein Details
Accession J9D885    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-28GFDYKTKYQKTPKLIHRNVKKIFSHydrophilic
55-84KIERRTRCFKNKPKMKTVQRAKPPQKKIVEHydrophilic
NLS Segment(s)
PositionSequence
64-78KNKPKMKTVQRAKPP
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009091  RCC1/BLIP-II  
Amino Acid Sequences FCIIGFDYKTKYQKTPKLIHRNVKKIFSTDNVITMLLKTGGVVSYGADLWRDRFKIERRTRCFKNKPKMKTVQRAKPPQKKIVEISGGDHHMLGITYGGNVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.67
3 0.7
4 0.76
5 0.81
6 0.83
7 0.83
8 0.85
9 0.81
10 0.78
11 0.7
12 0.61
13 0.55
14 0.49
15 0.45
16 0.35
17 0.32
18 0.26
19 0.24
20 0.21
21 0.18
22 0.15
23 0.09
24 0.08
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.04
31 0.05
32 0.05
33 0.05
34 0.06
35 0.06
36 0.07
37 0.1
38 0.1
39 0.1
40 0.16
41 0.22
42 0.32
43 0.42
44 0.5
45 0.55
46 0.63
47 0.7
48 0.75
49 0.79
50 0.79
51 0.8
52 0.79
53 0.79
54 0.8
55 0.83
56 0.82
57 0.82
58 0.82
59 0.81
60 0.81
61 0.86
62 0.87
63 0.87
64 0.84
65 0.83
66 0.78
67 0.74
68 0.68
69 0.65
70 0.6
71 0.51
72 0.47
73 0.43
74 0.39
75 0.34
76 0.3
77 0.22
78 0.16
79 0.15
80 0.12
81 0.07
82 0.06
83 0.06