Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A219AQV5

Protein Details
Accession A0A219AQV5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
67-91RCAAVDKKSKPRRVSKERRGGGRRSBasic
NLS Segment(s)
PositionSequence
73-93KKSKPRRVSKERRGGGRRSWR
Subcellular Location(s) cyto 12, nucl 10, pero 3
Family & Domain DBs
Amino Acid Sequences MGMDEGDVATSDEFDLEREFGLVRSNACLRHANAAWSWRPPVGARSGWAVVNSKKRNGRAAQDNMLRCAAVDKKSKPRRVSKERRGGGRRSWRGRCEDGVVDGDRIEGLVLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.08
5 0.08
6 0.08
7 0.08
8 0.12
9 0.12
10 0.11
11 0.15
12 0.17
13 0.17
14 0.2
15 0.24
16 0.21
17 0.27
18 0.27
19 0.25
20 0.25
21 0.29
22 0.27
23 0.26
24 0.26
25 0.2
26 0.2
27 0.18
28 0.19
29 0.18
30 0.17
31 0.16
32 0.18
33 0.19
34 0.18
35 0.18
36 0.19
37 0.18
38 0.27
39 0.28
40 0.3
41 0.33
42 0.34
43 0.39
44 0.39
45 0.41
46 0.41
47 0.44
48 0.45
49 0.47
50 0.46
51 0.42
52 0.39
53 0.33
54 0.24
55 0.22
56 0.18
57 0.18
58 0.24
59 0.28
60 0.38
61 0.48
62 0.56
63 0.6
64 0.68
65 0.73
66 0.77
67 0.84
68 0.84
69 0.85
70 0.84
71 0.87
72 0.82
73 0.77
74 0.76
75 0.76
76 0.75
77 0.74
78 0.75
79 0.71
80 0.72
81 0.71
82 0.64
83 0.58
84 0.51
85 0.44
86 0.41
87 0.37
88 0.3
89 0.25
90 0.22
91 0.16
92 0.14