Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D6X5

Protein Details
Accession J9D6X5    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
261-282NVYGATKVNKARKHKKFKKNRRBasic
NLS Segment(s)
PositionSequence
269-282NKARKHKKFKKNRR
Subcellular Location(s) extr 20, cyto 2, nucl 1, mito 1, pero 1, E.R. 1, vacu 1, mito_nucl 1
Family & Domain DBs
Amino Acid Sequences MQLLLSIFAILPFIASTANISIIPVPRGLTPGQTCRYYGYSDVIGSTQNISYLYNLLEYYNYPSAYIAAYNGDYSGVVLTNTGAIQPYNKFTNPTNYVFCQSGSMGITNEANMQEAATTQDANQVNQALRVSATTAPSTLTAPAAAAEAPLSLNVQQSIPDAVRGLPSSTFRCQNEAPQFRLNQAQSYYEEAPEAYFDATYTNKGNWTEYDSDFVASASLLKTNPVFNYFDESDNSAYLPGDFALHSSEDENYNYYDDSDNVYGATKVNKARKHKKFKKNRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.07
4 0.08
5 0.09
6 0.09
7 0.09
8 0.12
9 0.15
10 0.16
11 0.15
12 0.15
13 0.15
14 0.18
15 0.18
16 0.21
17 0.24
18 0.3
19 0.34
20 0.35
21 0.35
22 0.36
23 0.37
24 0.33
25 0.3
26 0.25
27 0.22
28 0.21
29 0.21
30 0.18
31 0.17
32 0.15
33 0.15
34 0.11
35 0.1
36 0.1
37 0.1
38 0.1
39 0.11
40 0.1
41 0.1
42 0.1
43 0.09
44 0.1
45 0.1
46 0.15
47 0.17
48 0.16
49 0.15
50 0.15
51 0.16
52 0.15
53 0.15
54 0.09
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.07
61 0.07
62 0.07
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.07
73 0.09
74 0.12
75 0.15
76 0.15
77 0.18
78 0.19
79 0.28
80 0.31
81 0.33
82 0.34
83 0.32
84 0.34
85 0.32
86 0.31
87 0.23
88 0.18
89 0.16
90 0.13
91 0.12
92 0.1
93 0.1
94 0.1
95 0.09
96 0.1
97 0.08
98 0.08
99 0.07
100 0.06
101 0.05
102 0.06
103 0.07
104 0.06
105 0.06
106 0.06
107 0.13
108 0.13
109 0.13
110 0.14
111 0.14
112 0.14
113 0.15
114 0.15
115 0.08
116 0.08
117 0.08
118 0.09
119 0.08
120 0.1
121 0.08
122 0.09
123 0.09
124 0.09
125 0.1
126 0.08
127 0.07
128 0.06
129 0.05
130 0.05
131 0.05
132 0.04
133 0.04
134 0.03
135 0.03
136 0.03
137 0.04
138 0.04
139 0.04
140 0.05
141 0.05
142 0.05
143 0.06
144 0.06
145 0.08
146 0.08
147 0.07
148 0.07
149 0.07
150 0.08
151 0.09
152 0.09
153 0.09
154 0.11
155 0.15
156 0.17
157 0.22
158 0.22
159 0.25
160 0.25
161 0.32
162 0.4
163 0.4
164 0.42
165 0.41
166 0.41
167 0.39
168 0.44
169 0.37
170 0.29
171 0.26
172 0.24
173 0.21
174 0.26
175 0.25
176 0.19
177 0.19
178 0.16
179 0.15
180 0.13
181 0.12
182 0.07
183 0.06
184 0.05
185 0.07
186 0.08
187 0.1
188 0.11
189 0.11
190 0.14
191 0.15
192 0.16
193 0.16
194 0.2
195 0.22
196 0.22
197 0.24
198 0.22
199 0.21
200 0.2
201 0.19
202 0.13
203 0.09
204 0.09
205 0.06
206 0.08
207 0.07
208 0.08
209 0.1
210 0.12
211 0.14
212 0.16
213 0.17
214 0.16
215 0.24
216 0.24
217 0.25
218 0.24
219 0.25
220 0.24
221 0.22
222 0.21
223 0.14
224 0.13
225 0.11
226 0.1
227 0.07
228 0.07
229 0.07
230 0.07
231 0.09
232 0.09
233 0.1
234 0.1
235 0.12
236 0.13
237 0.14
238 0.16
239 0.15
240 0.15
241 0.15
242 0.15
243 0.15
244 0.14
245 0.18
246 0.17
247 0.16
248 0.15
249 0.16
250 0.15
251 0.15
252 0.17
253 0.18
254 0.25
255 0.33
256 0.4
257 0.5
258 0.61
259 0.7
260 0.78
261 0.84
262 0.87