Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179FRB8

Protein Details
Accession A0A179FRB8    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
87-112QYQHHSTRRLSWKRRRHCVCGDSRLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MWCGSNVWWDDGWMADSSGPVQSNRIQPAKYSRTRQRSGQIKSGQVWSGRILSGQSVWWSIWCGPVWSVWSSQVESCESPALQFTAQYQHHSTRRLSWKRRRHCVCGDSRLGGSCTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.09
3 0.09
4 0.1
5 0.12
6 0.12
7 0.11
8 0.13
9 0.17
10 0.23
11 0.29
12 0.31
13 0.29
14 0.31
15 0.4
16 0.47
17 0.49
18 0.52
19 0.56
20 0.61
21 0.65
22 0.67
23 0.67
24 0.67
25 0.65
26 0.65
27 0.6
28 0.55
29 0.53
30 0.51
31 0.44
32 0.35
33 0.31
34 0.23
35 0.19
36 0.16
37 0.14
38 0.11
39 0.09
40 0.09
41 0.08
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.08
48 0.09
49 0.09
50 0.09
51 0.08
52 0.09
53 0.11
54 0.11
55 0.12
56 0.11
57 0.13
58 0.13
59 0.14
60 0.14
61 0.14
62 0.14
63 0.14
64 0.13
65 0.12
66 0.11
67 0.11
68 0.11
69 0.09
70 0.09
71 0.09
72 0.16
73 0.17
74 0.2
75 0.23
76 0.29
77 0.34
78 0.37
79 0.37
80 0.39
81 0.49
82 0.56
83 0.63
84 0.66
85 0.73
86 0.8
87 0.89
88 0.87
89 0.85
90 0.84
91 0.84
92 0.83
93 0.81
94 0.76
95 0.68
96 0.62
97 0.57