Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179EYW7

Protein Details
Accession A0A179EYW7    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
87-107ELRSLKQKLKRELKQKIRDDWHydrophilic
NLS Segment(s)
PositionSequence
72-101RKSHRGSEQHKKTHRELRSLKQKLKRELKQ
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR021842  DUF3435  
Pfam View protein in Pfam  
PF11917  DUF3435  
Amino Acid Sequences MLTLNDPGSFTALVRAYSWAIIRRQKPQQALIDQACSIGHSMSKRRPTGLTAEQTASVASDHRVRRLTVQLRKSHRGSEQHKKTHRELRSLKQKLKRELKQKIRDDWTDEQAVDDIERQLQGIGFAKPMEDDAIRPQRPAQKLLVETLTAPVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.16
4 0.18
5 0.2
6 0.2
7 0.25
8 0.32
9 0.35
10 0.42
11 0.5
12 0.55
13 0.57
14 0.59
15 0.61
16 0.57
17 0.6
18 0.54
19 0.48
20 0.41
21 0.37
22 0.29
23 0.21
24 0.18
25 0.11
26 0.11
27 0.11
28 0.18
29 0.24
30 0.32
31 0.33
32 0.34
33 0.36
34 0.35
35 0.39
36 0.41
37 0.38
38 0.33
39 0.33
40 0.3
41 0.29
42 0.27
43 0.19
44 0.12
45 0.09
46 0.07
47 0.13
48 0.14
49 0.17
50 0.19
51 0.19
52 0.22
53 0.3
54 0.37
55 0.38
56 0.44
57 0.48
58 0.53
59 0.58
60 0.57
61 0.52
62 0.48
63 0.5
64 0.5
65 0.53
66 0.56
67 0.59
68 0.65
69 0.66
70 0.67
71 0.67
72 0.64
73 0.63
74 0.6
75 0.61
76 0.65
77 0.67
78 0.69
79 0.68
80 0.72
81 0.72
82 0.76
83 0.74
84 0.73
85 0.76
86 0.8
87 0.82
88 0.8
89 0.79
90 0.75
91 0.7
92 0.67
93 0.61
94 0.54
95 0.46
96 0.4
97 0.32
98 0.26
99 0.23
100 0.17
101 0.14
102 0.1
103 0.08
104 0.08
105 0.08
106 0.08
107 0.08
108 0.09
109 0.1
110 0.1
111 0.11
112 0.11
113 0.11
114 0.1
115 0.11
116 0.12
117 0.1
118 0.11
119 0.19
120 0.3
121 0.3
122 0.31
123 0.36
124 0.42
125 0.45
126 0.47
127 0.43
128 0.4
129 0.42
130 0.45
131 0.42
132 0.35
133 0.32