Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DKM7

Protein Details
Accession J9DKM7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-48GNTFILKKYKNKERIKKLKEKCFTLHydrophilic
NLS Segment(s)
PositionSequence
33-40KNKERIKK
Subcellular Location(s) nucl 10, mito 9, cyto 5, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFLYICYKYKLDVDISGLYITVIGNTFILKKYKNKERIKKLKEKCFTLEIIKKIVSNNYYVNHRLGKSIYNDNGNDSKASSAFDNKNYYTSINKNLLLKFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.22
4 0.19
5 0.16
6 0.13
7 0.11
8 0.07
9 0.06
10 0.05
11 0.05
12 0.06
13 0.07
14 0.09
15 0.12
16 0.14
17 0.21
18 0.29
19 0.39
20 0.49
21 0.58
22 0.66
23 0.75
24 0.83
25 0.86
26 0.88
27 0.87
28 0.87
29 0.82
30 0.76
31 0.68
32 0.6
33 0.53
34 0.5
35 0.46
36 0.37
37 0.33
38 0.29
39 0.27
40 0.24
41 0.25
42 0.19
43 0.16
44 0.17
45 0.17
46 0.2
47 0.21
48 0.23
49 0.23
50 0.23
51 0.22
52 0.2
53 0.22
54 0.23
55 0.28
56 0.28
57 0.3
58 0.3
59 0.32
60 0.34
61 0.31
62 0.27
63 0.21
64 0.19
65 0.15
66 0.16
67 0.13
68 0.19
69 0.21
70 0.26
71 0.31
72 0.3
73 0.32
74 0.32
75 0.32
76 0.31
77 0.32
78 0.35
79 0.35
80 0.38
81 0.41