Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179FCL0

Protein Details
Accession A0A179FCL0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-70VDENGRRKRWRRRETTETRDGIBasic
NLS Segment(s)
PositionSequence
54-60RRKRWRR
Subcellular Location(s) extr 9, plas 5, E.R. 5, golg 4, mito 2
Family & Domain DBs
Gene Ontology GO:0016757  F:glycosyltransferase activity  
Amino Acid Sequences MPPHLHPRSRMTSSLFATTLVASFFVVALPHLLPCPVPRTKYADGEVIVDENGRRKRWRRRETTETRDGIVQFNQTTDDYADSTSERTRRECPVPKPGGMLGEWLGFHKNDDKQPGKRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.33
4 0.29
5 0.26
6 0.21
7 0.14
8 0.11
9 0.07
10 0.07
11 0.06
12 0.06
13 0.05
14 0.05
15 0.06
16 0.06
17 0.06
18 0.07
19 0.07
20 0.07
21 0.08
22 0.14
23 0.15
24 0.17
25 0.19
26 0.27
27 0.3
28 0.34
29 0.34
30 0.32
31 0.29
32 0.29
33 0.27
34 0.19
35 0.16
36 0.12
37 0.1
38 0.13
39 0.16
40 0.17
41 0.21
42 0.28
43 0.39
44 0.5
45 0.6
46 0.63
47 0.69
48 0.77
49 0.83
50 0.83
51 0.81
52 0.71
53 0.62
54 0.54
55 0.46
56 0.37
57 0.29
58 0.22
59 0.14
60 0.13
61 0.14
62 0.11
63 0.12
64 0.1
65 0.1
66 0.09
67 0.09
68 0.1
69 0.09
70 0.1
71 0.13
72 0.16
73 0.17
74 0.2
75 0.24
76 0.29
77 0.38
78 0.45
79 0.47
80 0.54
81 0.57
82 0.55
83 0.54
84 0.5
85 0.43
86 0.34
87 0.31
88 0.21
89 0.18
90 0.17
91 0.15
92 0.16
93 0.14
94 0.15
95 0.2
96 0.24
97 0.28
98 0.38
99 0.44