Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179FDN4

Protein Details
Accession A0A179FDN4   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
25-44SLMAPKPKPQQPPKMSHPNPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, nucl 9, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011146  HIT-like  
IPR036265  HIT-like_sf  
IPR032566  Znf-C2HE  
Gene Ontology GO:0005634  C:nucleus  
GO:0003824  F:catalytic activity  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0006139  P:nucleobase-containing compound metabolic process  
Pfam View protein in Pfam  
PF01230  HIT  
PF16278  zf-C2HE  
Amino Acid Sequences MDSDPDEAITKDEIQGTAPTPQNASLMAPKPKPQQPPKMSHPNPFKNRDSLGAYISSPSSFPPSVIIYQNADFVAIHDKYPKSTIHTLLLPRSPAHNLLHPYEAFKDAAFLEKVQAEALKLKKLVAAELQRRLGRYSKADAKRQAVLDGEECEELPAGRDWEAEVKVGVHAVPSMSHLHVHVLSRDMHSGSMRHRKHYNSFNTPFLVDVGDFPMGEGDGRLDPRGEGYLRRELRCWRCGRGFGNRFAKLKEHLEGEFTAWRAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.18
4 0.23
5 0.25
6 0.24
7 0.23
8 0.24
9 0.23
10 0.22
11 0.22
12 0.23
13 0.26
14 0.33
15 0.34
16 0.39
17 0.47
18 0.53
19 0.61
20 0.63
21 0.67
22 0.68
23 0.74
24 0.77
25 0.8
26 0.78
27 0.77
28 0.79
29 0.78
30 0.78
31 0.77
32 0.72
33 0.66
34 0.64
35 0.59
36 0.52
37 0.44
38 0.37
39 0.31
40 0.28
41 0.23
42 0.22
43 0.17
44 0.13
45 0.12
46 0.15
47 0.13
48 0.13
49 0.14
50 0.16
51 0.19
52 0.21
53 0.22
54 0.19
55 0.2
56 0.21
57 0.19
58 0.16
59 0.13
60 0.12
61 0.16
62 0.14
63 0.14
64 0.17
65 0.18
66 0.19
67 0.21
68 0.21
69 0.21
70 0.25
71 0.27
72 0.26
73 0.29
74 0.31
75 0.32
76 0.33
77 0.28
78 0.25
79 0.24
80 0.22
81 0.22
82 0.21
83 0.22
84 0.22
85 0.23
86 0.26
87 0.24
88 0.24
89 0.22
90 0.22
91 0.17
92 0.14
93 0.13
94 0.1
95 0.13
96 0.12
97 0.1
98 0.1
99 0.1
100 0.1
101 0.09
102 0.09
103 0.07
104 0.11
105 0.13
106 0.14
107 0.14
108 0.14
109 0.15
110 0.15
111 0.15
112 0.15
113 0.21
114 0.23
115 0.27
116 0.3
117 0.3
118 0.3
119 0.31
120 0.29
121 0.24
122 0.23
123 0.24
124 0.3
125 0.35
126 0.4
127 0.43
128 0.43
129 0.44
130 0.42
131 0.38
132 0.29
133 0.25
134 0.2
135 0.17
136 0.15
137 0.12
138 0.11
139 0.1
140 0.09
141 0.07
142 0.07
143 0.07
144 0.07
145 0.07
146 0.07
147 0.07
148 0.1
149 0.11
150 0.1
151 0.09
152 0.09
153 0.09
154 0.09
155 0.08
156 0.05
157 0.05
158 0.05
159 0.05
160 0.06
161 0.08
162 0.09
163 0.09
164 0.09
165 0.11
166 0.13
167 0.14
168 0.13
169 0.13
170 0.14
171 0.15
172 0.16
173 0.15
174 0.14
175 0.14
176 0.16
177 0.21
178 0.3
179 0.3
180 0.34
181 0.39
182 0.43
183 0.5
184 0.57
185 0.59
186 0.59
187 0.61
188 0.59
189 0.56
190 0.51
191 0.43
192 0.34
193 0.26
194 0.16
195 0.13
196 0.12
197 0.11
198 0.1
199 0.1
200 0.09
201 0.08
202 0.08
203 0.07
204 0.07
205 0.09
206 0.1
207 0.11
208 0.11
209 0.11
210 0.13
211 0.16
212 0.15
213 0.17
214 0.21
215 0.3
216 0.36
217 0.38
218 0.4
219 0.46
220 0.53
221 0.58
222 0.58
223 0.56
224 0.56
225 0.61
226 0.63
227 0.65
228 0.63
229 0.64
230 0.69
231 0.68
232 0.64
233 0.6
234 0.59
235 0.53
236 0.51
237 0.46
238 0.4
239 0.34
240 0.35
241 0.33
242 0.32
243 0.3