Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8ZW52

Protein Details
Accession J8ZW52    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
34-58QDDEYKRYKREHRDQKKYIRRHMERBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 5, golg 4, mito 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQLSNHFSGIPNELADFSINGNMLDEMPSFFKIQDDEYKRYKREHRDQKKYIRRHMERKNFILTEFQMSLIFLCVFLFTAFVVAFVFDDSRNFVIKNIPIIGRLFTVFYND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.13
4 0.1
5 0.11
6 0.1
7 0.1
8 0.1
9 0.1
10 0.09
11 0.1
12 0.09
13 0.08
14 0.09
15 0.11
16 0.11
17 0.1
18 0.11
19 0.11
20 0.13
21 0.21
22 0.26
23 0.29
24 0.37
25 0.43
26 0.44
27 0.49
28 0.54
29 0.55
30 0.6
31 0.67
32 0.7
33 0.75
34 0.81
35 0.86
36 0.88
37 0.85
38 0.83
39 0.82
40 0.78
41 0.77
42 0.79
43 0.79
44 0.75
45 0.7
46 0.68
47 0.57
48 0.5
49 0.44
50 0.35
51 0.28
52 0.23
53 0.2
54 0.14
55 0.14
56 0.13
57 0.11
58 0.1
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.04
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.09
77 0.11
78 0.12
79 0.12
80 0.13
81 0.17
82 0.19
83 0.23
84 0.24
85 0.23
86 0.24
87 0.25
88 0.25
89 0.21
90 0.2
91 0.18