Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9DVF5

Protein Details
Accession J9DVF5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSKTSKRDLKLQQKEKYIKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR015418  Eaf6  
Gene Ontology GO:0000123  C:histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0006325  P:chromatin organization  
GO:0016573  P:histone acetylation  
Pfam View protein in Pfam  
PF09340  NuA4  
Amino Acid Sequences MSKTSKRDLKLQQKEKYIKALLKKRSEIKERIEKIENELYNCETSFLEFSGGYPITKTLEQYLTTRVFQKKNIKEEDRIFSVEKHNDKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.75
3 0.72
4 0.66
5 0.6
6 0.6
7 0.61
8 0.6
9 0.62
10 0.65
11 0.65
12 0.68
13 0.7
14 0.66
15 0.66
16 0.67
17 0.63
18 0.62
19 0.59
20 0.51
21 0.49
22 0.5
23 0.43
24 0.34
25 0.32
26 0.28
27 0.23
28 0.23
29 0.18
30 0.11
31 0.1
32 0.09
33 0.08
34 0.08
35 0.07
36 0.07
37 0.09
38 0.1
39 0.09
40 0.09
41 0.09
42 0.1
43 0.11
44 0.11
45 0.11
46 0.13
47 0.15
48 0.16
49 0.21
50 0.22
51 0.23
52 0.29
53 0.32
54 0.32
55 0.38
56 0.47
57 0.5
58 0.56
59 0.64
60 0.62
61 0.64
62 0.68
63 0.67
64 0.61
65 0.56
66 0.49
67 0.43
68 0.46
69 0.47
70 0.46