Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179FXQ4

Protein Details
Accession A0A179FXQ4    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
115-135AVAKVQPKKKEKKDGDNFGERBasic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto_nucl 6, nucl 5.5, cyto 5.5, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001529  DNA-dir_RNA_pol_M/15kDasu  
IPR012164  Rpa12/Rpb9/Rpc10/TFS  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF02150  RNA_POL_M_15KD  
Amino Acid Sequences MATPQSTTSYEGSGPKKLEQITFRFCSECSNMLYPKEDEDAHKLQFTCRTCQYTEEAQSTCVFRNVLNNSAGETAGVTQDVGSDPTVSDVPLVLCLGCGCLIFCDTCGGMAADMAVAKVQPKKKEKKDGDNFGERSHYVPWNESDDPFAEYDEELMEDVDYGLPSPTPTDYTSDTTFAAGFSDDGAMVCNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.36
4 0.36
5 0.39
6 0.38
7 0.42
8 0.45
9 0.46
10 0.45
11 0.41
12 0.38
13 0.38
14 0.35
15 0.31
16 0.28
17 0.3
18 0.31
19 0.31
20 0.35
21 0.3
22 0.29
23 0.28
24 0.25
25 0.22
26 0.27
27 0.29
28 0.27
29 0.3
30 0.28
31 0.27
32 0.33
33 0.33
34 0.31
35 0.33
36 0.35
37 0.32
38 0.34
39 0.37
40 0.36
41 0.38
42 0.36
43 0.31
44 0.29
45 0.3
46 0.29
47 0.25
48 0.2
49 0.16
50 0.12
51 0.19
52 0.2
53 0.22
54 0.21
55 0.21
56 0.2
57 0.2
58 0.2
59 0.13
60 0.1
61 0.07
62 0.06
63 0.06
64 0.05
65 0.04
66 0.04
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.06
73 0.07
74 0.06
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.03
87 0.04
88 0.04
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.06
95 0.06
96 0.05
97 0.05
98 0.04
99 0.03
100 0.04
101 0.03
102 0.03
103 0.03
104 0.05
105 0.1
106 0.15
107 0.22
108 0.31
109 0.42
110 0.51
111 0.62
112 0.67
113 0.74
114 0.8
115 0.82
116 0.8
117 0.79
118 0.72
119 0.62
120 0.57
121 0.46
122 0.38
123 0.31
124 0.28
125 0.2
126 0.22
127 0.22
128 0.26
129 0.27
130 0.26
131 0.24
132 0.21
133 0.22
134 0.2
135 0.18
136 0.12
137 0.1
138 0.11
139 0.09
140 0.08
141 0.07
142 0.06
143 0.06
144 0.05
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.08
153 0.08
154 0.1
155 0.12
156 0.15
157 0.19
158 0.24
159 0.26
160 0.26
161 0.25
162 0.23
163 0.22
164 0.18
165 0.16
166 0.11
167 0.09
168 0.08
169 0.08
170 0.07
171 0.07